PDB entry 2oqn

View 2oqn on RCSB PDB site
Description: High Pressure Cryocooling of Capillary Sample Cryoprotection and Diffraction Phasing at Long Wavelengths
Class: Plant Protein
Keywords: high pressure cryocooling, capillary cryoprotection, sulfur SAD phasing, Plant Protein
Deposited on 2007-01-31, released 2007-05-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.178
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thaumatin-1
    Species: THAUMATOCOCCUS DANIELLII [TaxId:4621]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2oqna_
  • Heterogens: TAR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2oqnA (A:)
    atfeivnrcsytvwaaaskgdaaldaggrqlnsgeswtinvepgtnggkiwartdcyfdd
    sgsgicktgdcggllrckrfgrppttlaefslnqygkdyidisnikgfnvpmnfspttrg
    crgvrcaadivgqcpaklkapgggcndactvfqtseyccttgkcgpteysrffkrlcpda
    fsyvldkpttvtcpgssnyrvtfcpta