PDB entry 2oq1

View 2oq1 on RCSB PDB site
Description: Tandem SH2 domains of ZAP-70 with 19-mer zeta1 peptide
Class: transferase
Keywords: tandem SH2 domains, ZAP-70, tyrosine kinase, TRANSFERASE
Deposited on 2007-01-30, released 2007-03-06
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.209
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: tyrosine-protein kinase zap-70
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P43403 (0-253)
    • modified residue (26)
    • modified residue (119)
    • modified residue (158)
  Domains in SCOPe 2.05: d2oq1a1, d2oq1a2
• Chain 'B':
  Compound: T-cell surface glycoprotein CD3 zeta chain
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • Uniprot P20963 (0-18)
    • modified residue (3)
    • modified residue (14)
• Heterogens: PB, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2oq1A (A:)
  dpaahlpffygsisraeaeehlklagmadglfllrqclrslggyvlslvhdvrfhhfpie
  rqlngtyaiaggkahcgpaelcefysrdpdglpcnlrkpcnrpsglepqpgvfdclrdam
  vrdyvrqtwklegealeqaiisqapqvekliattahermpwyhssltreeaerklysgaq
  tdgkfllrprkeqgtyalsliygktvyhylisqdkagkycipegtkfdtlwqlveylklk
  adgliyclkeacpn
  

  
  
• Chain 'B':
  No sequence available.