PDB entry 2opz

View 2opz on RCSB PDB site
Description: AVPF bound to BIR3-XIAP
Class: apoptosis inhibitor
Keywords: Tetrapeptide, BIR3 domain of XIAP, apoptosis inhibitor
Deposited on 2007-01-30, released 2007-02-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-09-04, with a file datestamp of 2019-08-30.
Experiment type: XRAY
Resolution: 3 Å
R-factor: N/A
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: baculoviral iap repeat-containing protein 4
    Species: Homo sapiens [TaxId:9606]
    Gene: BIRC4, API3, IAP3, XIAP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2opza_
  • Chain 'B':
    Compound: baculoviral iap repeat-containing protein 4
    Species: Homo sapiens [TaxId:9606]
    Gene: BIRC4, API3, IAP3, XIAP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2opzb_
  • Chain 'C':
    Compound: baculoviral iap repeat-containing protein 4
    Species: Homo sapiens [TaxId:9606]
    Gene: BIRC4, API3, IAP3, XIAP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2opzc_
  • Chain 'D':
    Compound: baculoviral iap repeat-containing protein 4
    Species: Homo sapiens [TaxId:9606]
    Gene: BIRC4, API3, IAP3, XIAP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2opzd_
  • Chain 'E':
    Compound: AVPF (Smac homologue, N-terminal tetrapeptide)
    Database cross-references and differences (RAF-indexed):
    • PDB 2OPZ (0-3)
  • Chain 'F':
    Compound: AVPF (Smac homologue, N-terminal tetrapeptide)
    Database cross-references and differences (RAF-indexed):
    • PDB 2OPZ (0-3)
  • Chain 'G':
    Compound: AVPF (Smac homologue, N-terminal tetrapeptide)
    Database cross-references and differences (RAF-indexed):
    • PDB 2OPZ (0-3)
  • Chain 'H':
    Compound: AVPF (Smac homologue, N-terminal tetrapeptide)
    Database cross-references and differences (RAF-indexed):
    • PDB 2OPZ (0-3)
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2opzA (A:)
nfpnstnlprnpsmadyeariftfgtwiysvnkeqlaragfyalgegdkvkcfhcggglt
dwkpsedpweqhakwypgckylleqkgqeyinnihlthsleeclvrtte

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2opzB (B:)
nfpnstnlprnpsmadyeariftfgtwiysvnkeqlaragfyalgegdkvkcfhcggglt
dwkpsedpweqhakwypgckylleqkgqeyinnihlthsleeclvrtte

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2opzC (C:)
nfpnstnlprnpsmadyeariftfgtwiysvnkeqlaragfyalgegdkvkcfhcggglt
dwkpsedpweqhakwypgckylleqkgqeyinnihlthsleeclvrtte

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2opzD (D:)
nfpnstnlprnpsmadyeariftfgtwiysvnkeqlaragfyalgegdkvkcfhcggglt
dwkpsedpweqhakwypgckylleqkgqeyinnihlthsleeclvrtte

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.