PDB entry 2opu

View 2opu on RCSB PDB site
Description: Solution NMR Structure of the First Domain of KSRP
Class: RNA binding protein
Keywords: kh domain, RNA binding protein, ksrp
Deposited on 2007-01-30, released 2008-02-26
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-03-17, with a file datestamp of 2009-03-13.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: KHSRP protein
    Species: Homo sapiens [TaxId:9606]
    Gene: KHSRP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2opua_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2opuA (A:)
issqlgpihppprtsmteeyrvpdgmvgliigrggeqinkiqqdsgckvqispdsgglpe
rsvsltgapesvqkakmmlddivsrgrgg