PDB entry 2opo

View 2opo on RCSB PDB site
Description: Crystal structure of the calcium-binding pollen allergen Che a 3
Class: allergen
Keywords: calcium-binding protein, dimer, domain-swapping, EF-hand, ALLERGEN
Deposited on 2007-01-29, released 2007-02-06
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.202
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Polcalcin Che a 3
    Species: Chenopodium album [TaxId:3559]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2opoa_
  • Chain 'B':
    Compound: Polcalcin Che a 3
    Species: Chenopodium album [TaxId:3559]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2opob_
  • Chain 'C':
    Compound: Polcalcin Che a 3
    Species: Chenopodium album [TaxId:3559]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2opoc_
  • Chain 'D':
    Compound: Polcalcin Che a 3
    Species: Chenopodium album [TaxId:3559]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2opod_
  • Heterogens: CA, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2opoA (A:)
    maaedtpqdiadrerifkrfdtngdgkissselgdalktlgsvtpdevrrmmaeidtdgd
    gfisfdeftdfaranrglvkdvskif
    

    Sequence, based on observed residues (ATOM records): (download)
    >2opoA (A:)
    tpqdiadrerifkrfdtngdgkissselgdalktlgsvtpdevrrmmaeidtdgdgfisf
    deftdfaranrglvkdvskif
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2opoB (B:)
    maaedtpqdiadrerifkrfdtngdgkissselgdalktlgsvtpdevrrmmaeidtdgd
    gfisfdeftdfaranrglvkdvskif
    

    Sequence, based on observed residues (ATOM records): (download)
    >2opoB (B:)
    tpqdiadrerifkrfdtngdgkissselgdalktlgsvtpdevrrmmaeidtdgdgfisf
    deftdfaranrglvkdvskif
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2opoC (C:)
    maaedtpqdiadrerifkrfdtngdgkissselgdalktlgsvtpdevrrmmaeidtdgd
    gfisfdeftdfaranrglvkdvskif
    

    Sequence, based on observed residues (ATOM records): (download)
    >2opoC (C:)
    aaedtpqdiadrerifkrfdtngdgkissselgdalktlgsvtpdevrrmmaeidtdgdg
    fisfdeftdfaranrglvkdvskif
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2opoD (D:)
    maaedtpqdiadrerifkrfdtngdgkissselgdalktlgsvtpdevrrmmaeidtdgd
    gfisfdeftdfaranrglvkdvskif
    

    Sequence, based on observed residues (ATOM records): (download)
    >2opoD (D:)
    dtpqdiadrerifkrfdtngdgkissselgdalktlgsvtpdevrrmmaeidtdgdgfis
    fdeftdfaranrglvkdvskif