PDB entry 2op7

View 2op7 on RCSB PDB site
Description: ww4
Class: ligase
Keywords: WW domain, Beta sheet, LIGASE
Deposited on 2007-01-27, released 2007-12-11
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: NEDD4-like E3 ubiquitin-protein ligase WWP1
    Species: Homo sapiens [TaxId:9606]
    Gene: WWP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2op7a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2op7A (A:)
    neeplpegweirytregvryfvdhntrtttfkdprngks