PDB entry 2ooz
View 2ooz on RCSB PDB site
Description: Macrophage Migration Inhibitory Factor (MIF) Complexed with OXIM6 (an OXIM Derivative Not Containing a Ring in its R-group)
Class: isomerase
Keywords: alternative ligand-binding modes, ISOMERASE
Deposited on
2007-01-26, released
2007-06-05
The last revision prior to the SCOPe 2.07 freeze date was dated
2017-10-18, with a file datestamp of
2017-10-13.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: macrophage migration inhibitory factor
Species: Homo sapiens [TaxId:9606]
Gene: MIF
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.07: d2ooza_ - Chain 'B':
Compound: macrophage migration inhibitory factor
Species: Homo sapiens [TaxId:9606]
Gene: MIF
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.07: d2oozb_ - Chain 'C':
Compound: macrophage migration inhibitory factor
Species: Homo sapiens [TaxId:9606]
Gene: MIF
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.07: d2oozc_ - Heterogens: SO4, OX5, GOL, IPA, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>2oozA (A:)
pmfivntnvprasvpdgflseltqqlaqatgkppqyiavhvvpdqlmafggssepcalcs
lhsigkiggaqnrsyskllcgllaerlrispdrvyinyydmnaanvgwnnstfa
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>2oozB (B:)
pmfivntnvprasvpdgflseltqqlaqatgkppqyiavhvvpdqlmafggssepcalcs
lhsigkiggaqnrsyskllcgllaerlrispdrvyinyydmnaanvgwnnstfa
- Chain 'C':
Sequence; same for both SEQRES and ATOM records: (download)
>2oozC (C:)
pmfivntnvprasvpdgflseltqqlaqatgkppqyiavhvvpdqlmafggssepcalcs
lhsigkiggaqnrsyskllcgllaerlrispdrvyinyydmnaanvgwnnstfa