PDB entry 2ooz

View 2ooz on RCSB PDB site
Description: Macrophage Migration Inhibitory Factor (MIF) Complexed with OXIM6 (an OXIM Derivative Not Containing a Ring in its R-group)
Class: isomerase
Keywords: alternative ligand-binding modes, ISOMERASE
Deposited on 2007-01-26, released 2007-06-05
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: macrophage migration inhibitory factor
  Species: Homo sapiens [TaxId:9606]
  Gene: MIF
  Database cross-references and differences (RAF-indexed):
  • Uniprot P14174 (0-113)
  Domains in SCOPe 2.08: d2ooza_
• Chain 'B':
  Compound: macrophage migration inhibitory factor
  Species: Homo sapiens [TaxId:9606]
  Gene: MIF
  Database cross-references and differences (RAF-indexed):
  • Uniprot P14174 (0-113)
  Domains in SCOPe 2.08: d2oozb_
• Chain 'C':
  Compound: macrophage migration inhibitory factor
  Species: Homo sapiens [TaxId:9606]
  Gene: MIF
  Database cross-references and differences (RAF-indexed):
  • Uniprot P14174 (0-113)
  Domains in SCOPe 2.08: d2oozc_
• Heterogens: SO4, OX5, GOL, IPA, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2oozA (A:)
  pmfivntnvprasvpdgflseltqqlaqatgkppqyiavhvvpdqlmafggssepcalcs
  lhsigkiggaqnrsyskllcgllaerlrispdrvyinyydmnaanvgwnnstfa
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2oozB (B:)
  pmfivntnvprasvpdgflseltqqlaqatgkppqyiavhvvpdqlmafggssepcalcs
  lhsigkiggaqnrsyskllcgllaerlrispdrvyinyydmnaanvgwnnstfa
  

  
  
• Chain 'C':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2oozC (C:)
  pmfivntnvprasvpdgflseltqqlaqatgkppqyiavhvvpdqlmafggssepcalcs
  lhsigkiggaqnrsyskllcgllaerlrispdrvyinyydmnaanvgwnnstfa