PDB entry 2ooy

View 2ooy on RCSB PDB site
Description: Crystal structure of the adenylate sensor from AMP-activated protein kinase complexed with ATP
Class: transferase
Keywords: AMPK, kinase, AMP, crystal structure, TRANSFERASE
Deposited on 2007-01-26, released 2007-02-06
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.88 Å
R-factor: 0.195
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: SNF1-like protein kinase ssp2
    Species: Schizosaccharomyces pombe [TaxId:4896]
    Gene: ssp2, SPCC74.03c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2ooya_
  • Chain 'B':
    Compound: SPCC1919.03c protein
    Species: Schizosaccharomyces pombe [TaxId:4896]
    Gene: SPCC1919.03c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2ooyb_
  • Chain 'C':
    Compound: SNF1-like protein kinase ssp2
    Species: Schizosaccharomyces pombe [TaxId:4896]
    Gene: ssp2, SPCC74.03c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2ooyc_
  • Chain 'D':
    Compound: SPCC1919.03c protein
    Species: Schizosaccharomyces pombe [TaxId:4896]
    Gene: SPCC1919.03c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2ooyd_
  • Chain 'E':
    Compound: Hypothetical protein C1556.08c in chromosome I
    Species: Schizosaccharomyces pombe [TaxId:4896]
    Gene: SPAC1556.08c, SPAC1F12.01c
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q10343 (1-332)
      • cloning artifact (0)
    Domains in SCOPe 2.08: d2ooye1, d2ooye2, d2ooye3
  • Chain 'G':
    Compound: Hypothetical protein C1556.08c in chromosome I
    Species: Schizosaccharomyces pombe [TaxId:4896]
    Gene: SPAC1556.08c, SPAC1F12.01c
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q10343 (1-332)
      • cloning artifact (0)
    Domains in SCOPe 2.08: d2ooyg1, d2ooyg2, d2ooyg3
  • Heterogens: FLC, ATP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ooyA (A:)
    sqstrkksrrnkwhfgvrcrgdapeillavyralqragaqftvpkpvngkyrsdmytiks
    rweiphckregkntyayielqlyevmpgcfmldvksngykdiyshpertadhgmddlkss
    fpfldlcamlvcklfsa
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ooyA (A:)
    srrnkwhfgvrcrgdapeillavyralqragaqftvpkpvngkyrsdmytiksrweiphc
    kregkntyayielqlyevmpgcfmldvksngykdiyshpertadhgmddlkssfpfldlc
    amlvcklfs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2ooyB (B:)
    mseseqysteipafltsntlqelklpkppslpphlekcilnsntaykedqsvlpnpnhvl
    lnhlaaantqlgvlalsattryhrkyvttamfknfdv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ooyB (B:)
    eqysteipafltsntlqelklpkppslpphlekcilnsntaykedqsvlpnpnhvllnhl
    aaantqlgvlalsattryhrkyvttamfknfd
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2ooyC (C:)
    sqstrkksrrnkwhfgvrcrgdapeillavyralqragaqftvpkpvngkyrsdmytiks
    rweiphckregkntyayielqlyevmpgcfmldvksngykdiyshpertadhgmddlkss
    fpfldlcamlvcklfsa
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ooyC (C:)
    nkwhfgvrcrgdapeillavyralqragaqftvpkpvngkyrsdmytiksrweiphckre
    gkntyayielqlyevmpgcfmldvksngykdiyddlkssfpfldlcamlvcklfs
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2ooyD (D:)
    mseseqysteipafltsntlqelklpkppslpphlekcilnsntaykedqsvlpnpnhvl
    lnhlaaantqlgvlalsattryhrkyvttamfknfdv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ooyD (D:)
    qysteipafltsntlqelklpkppslpphlekcilnsntaykedqsvlpnpnhvllnhla
    aantqlgvlalsattryhrkyvttamfknfd
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ooyE (E:)
    mdvqetqkgalkeiqafirsrtsydvlptsfrlivfdvtlfvktslslltlnnivsaplw
    dseankfaglltmadfvnvikyyyqsssfpeaiaeidkfrllglreverkigaippetiy
    vhpmhslmdaclamsksrarriplidvdgetgsemivsvltqyrilkfismncketamlr
    vplnqmtigtwsnlatasmetkvydvikmlaeknisavpivnsegtllnvyesvdvmhli
    qdgdysnldlsvgeallkrpanfdgvhtcratdrldgifdaikhsrvhrlfvvdenlkle
    gilsladilnyiiydktttpgvpeqtdnfesav
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2ooyG (G:)
    mdvqetqkgalkeiqafirsrtsydvlptsfrlivfdvtlfvktslslltlnnivsaplw
    dseankfaglltmadfvnvikyyyqsssfpeaiaeidkfrllglreverkigaippetiy
    vhpmhslmdaclamsksrarriplidvdgetgsemivsvltqyrilkfismncketamlr
    vplnqmtigtwsnlatasmetkvydvikmlaeknisavpivnsegtllnvyesvdvmhli
    qdgdysnldlsvgeallkrpanfdgvhtcratdrldgifdaikhsrvhrlfvvdenlkle
    gilsladilnyiiydktttpgvpeqtdnfesav
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ooyG (G:)
    mdvqetqkgalkeiqafirsrtsydvlptsfrlivfdvtlfvktslslltlnnivsaplw
    dseankfaglltmadfvnvikyyyqsssfpeaiaeidkfrllglreverkigaippetiy
    vhpmhslmdaclamsksrarriplidvdgetgsemivsvltqyrilkfismncketamlr
    vplnqmtigtwsnlatasmetkvydvikmlaeknisavpivnsegtllnvyesvdvmhli
    qdgdysnldlsvgeallkrpanfdgvhtcratdrldgifdaikhsrvhrlfvvdenlkle
    gilsladilnyiiydktdnfesav