PDB entry 2oov

View 2oov on RCSB PDB site
Description: Crystal Structure of Hansenula polymorpha amine oxidase to 1.7 Angstroms
Class: oxidoreductase
Keywords: protein-derived cofactor, beta-sandwich, TPQ, OXIDOREDUCTASE
Deposited on 2007-01-26, released 2007-04-10
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-04-18, with a file datestamp of 2012-04-13.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.149
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peroxisomal copper amine oxidase
    Species: Pichia angusta [TaxId:4905]
    Gene: AMO
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2oova1, d2oova2, d2oova3
  • Chain 'B':
    Compound: Peroxisomal copper amine oxidase
    Species: Pichia angusta [TaxId:4905]
    Gene: AMO
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2oovb1, d2oovb2, d2oovb3
  • Chain 'C':
    Compound: Peroxisomal copper amine oxidase
    Species: Pichia angusta [TaxId:4905]
    Gene: AMO
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2oovc1, d2oovc2, d2oovc3
  • Chain 'D':
    Compound: Peroxisomal copper amine oxidase
    Species: Pichia angusta [TaxId:4905]
    Gene: AMO
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2oovd1, d2oovd2, d2oovd3
  • Chain 'E':
    Compound: Peroxisomal copper amine oxidase
    Species: Pichia angusta [TaxId:4905]
    Gene: AMO
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2oove1, d2oove2, d2oove3
  • Chain 'F':
    Compound: Peroxisomal copper amine oxidase
    Species: Pichia angusta [TaxId:4905]
    Gene: AMO
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2oovf1, d2oovf2, d2oovf3
  • Heterogens: CU, PO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2oovA (A:)
    aasaaparpahpldplstaeikaatntvksyfagkkisfntvtlreparkayiqwkeqgg
    plpprlayyvileagkpgvkeglvdlaslsvietraletvqpiltvedlcsteevirndp
    avieqcvlsgipanemhkvycdpwtigyderwgtgkrlqqalvyyrsdeddsqyshpldf
    cpivdteekkvifidipnrrrkvskhkhanfypkhmiekvgamrpeappinvtqpegvsf
    kmtgnvmewsnfkfhigfnyregivlsdvsyndhgnvrpifhrislsemivpygspefph
    qrkhaldigeygagymtnplslgcdckgvihyldahfsdragdpitvknavciheeddgl
    lfkhsdfrdnfatslvtratklvvsqiftaanyeyclywvfmqdgairldirltgilnty
    ilgddeeagpwgtrvypnvnahnhqhlfslridpridgdgnsaaacdaksspyplgspen
    mygnafysekttfktvkdsltnyesatgrswdifnpnkvnpysgkppsyklvstqcppll
    akegslvakrapwashsvnvvpykdnrlypsgdhvpqwsgdgvrgmrewigdgsenidnt
    dilffhtfgithfpapedfplmpaepitlmlrprhfftenpgldiqpsyamttseakrav
    

    Sequence, based on observed residues (ATOM records): (download)
    >2oovA (A:)
    parpahpldplstaeikaatntvksyfagkkisfntvtlreparkayiqwkeqggplppr
    layyvileagkpgvkeglvdlaslsvietraletvqpiltvedlcsteevirndpavieq
    cvlsgipanemhkvycdpwtigyderwgtgkrlqqalvyyrsdeddsqyshpldfcpivd
    teekkvifidipnrrrkvskhkhanfypkhmiekvgamrpeappinvtqpegvsfkmtgn
    vmewsnfkfhigfnyregivlsdvsyndhgnvrpifhrislsemivpygspefphqrkha
    ldigeygagymtnplslgcdckgvihyldahfsdragdpitvknavciheeddgllfkhs
    dfrdnfatslvtratklvvsqiftaanyeyclywvfmqdgairldirltgilntyilgdd
    eeagpwgtrvypnvnahnhqhlfslridpridgdgnsaaacdaksspyplgspenmygna
    fysekttfktvkdsltnyesatgrswdifnpnkvnpysgkppsyklvstqcppllakegs
    lvakrapwashsvnvvpykdnrlypsgdhvpqwsgdgvrgmrewigdgsenidntdilff
    htfgithfpapedfplmpaepitlmlrprhfftenpgldiqpsyamttseakrav
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2oovB (B:)
    aasaaparpahpldplstaeikaatntvksyfagkkisfntvtlreparkayiqwkeqgg
    plpprlayyvileagkpgvkeglvdlaslsvietraletvqpiltvedlcsteevirndp
    avieqcvlsgipanemhkvycdpwtigyderwgtgkrlqqalvyyrsdeddsqyshpldf
    cpivdteekkvifidipnrrrkvskhkhanfypkhmiekvgamrpeappinvtqpegvsf
    kmtgnvmewsnfkfhigfnyregivlsdvsyndhgnvrpifhrislsemivpygspefph
    qrkhaldigeygagymtnplslgcdckgvihyldahfsdragdpitvknavciheeddgl
    lfkhsdfrdnfatslvtratklvvsqiftaanyeyclywvfmqdgairldirltgilnty
    ilgddeeagpwgtrvypnvnahnhqhlfslridpridgdgnsaaacdaksspyplgspen
    mygnafysekttfktvkdsltnyesatgrswdifnpnkvnpysgkppsyklvstqcppll
    akegslvakrapwashsvnvvpykdnrlypsgdhvpqwsgdgvrgmrewigdgsenidnt
    dilffhtfgithfpapedfplmpaepitlmlrprhfftenpgldiqpsyamttseakrav
    

    Sequence, based on observed residues (ATOM records): (download)
    >2oovB (B:)
    parpahpldplstaeikaatntvksyfagkkisfntvtlreparkayiqwkeqggplppr
    layyvileagkpgvkeglvdlaslsvietraletvqpiltvedlcsteevirndpavieq
    cvlsgipanemhkvycdpwtigyderwgtgkrlqqalvyyrsdeddsqyshpldfcpivd
    teekkvifidipnrrrkvskhkhanfypkhmiekvgamrpeappinvtqpegvsfkmtgn
    vmewsnfkfhigfnyregivlsdvsyndhgnvrpifhrislsemivpygspefphqrkha
    ldigeygagymtnplslgcdckgvihyldahfsdragdpitvknavciheeddgllfkhs
    dfrdnfatslvtratklvvsqiftaanyeyclywvfmqdgairldirltgilntyilgdd
    eeagpwgtrvypnvnahnhqhlfslridpridgdgnsaaacdaksspyplgspenmygna
    fysekttfktvkdsltnyesatgrswdifnpnkvnpysgkppsyklvstqcppllakegs
    lvakrapwashsvnvvpykdnrlypsgdhvpqwsgdgvrgmrewigdgsenidntdilff
    htfgithfpapedfplmpaepitlmlrprhfftenpgldiqpsyamttseakrav
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2oovC (C:)
    aasaaparpahpldplstaeikaatntvksyfagkkisfntvtlreparkayiqwkeqgg
    plpprlayyvileagkpgvkeglvdlaslsvietraletvqpiltvedlcsteevirndp
    avieqcvlsgipanemhkvycdpwtigyderwgtgkrlqqalvyyrsdeddsqyshpldf
    cpivdteekkvifidipnrrrkvskhkhanfypkhmiekvgamrpeappinvtqpegvsf
    kmtgnvmewsnfkfhigfnyregivlsdvsyndhgnvrpifhrislsemivpygspefph
    qrkhaldigeygagymtnplslgcdckgvihyldahfsdragdpitvknavciheeddgl
    lfkhsdfrdnfatslvtratklvvsqiftaanyeyclywvfmqdgairldirltgilnty
    ilgddeeagpwgtrvypnvnahnhqhlfslridpridgdgnsaaacdaksspyplgspen
    mygnafysekttfktvkdsltnyesatgrswdifnpnkvnpysgkppsyklvstqcppll
    akegslvakrapwashsvnvvpykdnrlypsgdhvpqwsgdgvrgmrewigdgsenidnt
    dilffhtfgithfpapedfplmpaepitlmlrprhfftenpgldiqpsyamttseakrav
    

    Sequence, based on observed residues (ATOM records): (download)
    >2oovC (C:)
    parpahpldplstaeikaatntvksyfagkkisfntvtlreparkayiqwkeqggplppr
    layyvileagkpgvkeglvdlaslsvietraletvqpiltvedlcsteevirndpavieq
    cvlsgipanemhkvycdpwtigyderwgtgkrlqqalvyyrsdeddsqyshpldfcpivd
    teekkvifidipnrrrkvskhkhanfypkhmiekvgamrpeappinvtqpegvsfkmtgn
    vmewsnfkfhigfnyregivlsdvsyndhgnvrpifhrislsemivpygspefphqrkha
    ldigeygagymtnplslgcdckgvihyldahfsdragdpitvknavciheeddgllfkhs
    dfrdnfatslvtratklvvsqiftaanyeyclywvfmqdgairldirltgilntyilgdd
    eeagpwgtrvypnvnahnhqhlfslridpridgdgnsaaacdaksspyplgspenmygna
    fysekttfktvkdsltnyesatgrswdifnpnkvnpysgkppsyklvstqcppllakegs
    lvakrapwashsvnvvpykdnrlypsgdhvpqwsgdgvrgmrewigdgsenidntdilff
    htfgithfpapedfplmpaepitlmlrprhfftenpgldiqpsyamttseakrav
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2oovD (D:)
    aasaaparpahpldplstaeikaatntvksyfagkkisfntvtlreparkayiqwkeqgg
    plpprlayyvileagkpgvkeglvdlaslsvietraletvqpiltvedlcsteevirndp
    avieqcvlsgipanemhkvycdpwtigyderwgtgkrlqqalvyyrsdeddsqyshpldf
    cpivdteekkvifidipnrrrkvskhkhanfypkhmiekvgamrpeappinvtqpegvsf
    kmtgnvmewsnfkfhigfnyregivlsdvsyndhgnvrpifhrislsemivpygspefph
    qrkhaldigeygagymtnplslgcdckgvihyldahfsdragdpitvknavciheeddgl
    lfkhsdfrdnfatslvtratklvvsqiftaanyeyclywvfmqdgairldirltgilnty
    ilgddeeagpwgtrvypnvnahnhqhlfslridpridgdgnsaaacdaksspyplgspen
    mygnafysekttfktvkdsltnyesatgrswdifnpnkvnpysgkppsyklvstqcppll
    akegslvakrapwashsvnvvpykdnrlypsgdhvpqwsgdgvrgmrewigdgsenidnt
    dilffhtfgithfpapedfplmpaepitlmlrprhfftenpgldiqpsyamttseakrav
    

    Sequence, based on observed residues (ATOM records): (download)
    >2oovD (D:)
    parpahpldplstaeikaatntvksyfagkkisfntvtlreparkayiqwkeqggplppr
    layyvileagkpgvkeglvdlaslsvietraletvqpiltvedlcsteevirndpavieq
    cvlsgipanemhkvycdpwtigyderwgtgkrlqqalvyyrsdeddsqyshpldfcpivd
    teekkvifidipnrrrkvskhkhanfypkhmiekvgamrpeappinvtqpegvsfkmtgn
    vmewsnfkfhigfnyregivlsdvsyndhgnvrpifhrislsemivpygspefphqrkha
    ldigeygagymtnplslgcdckgvihyldahfsdragdpitvknavciheeddgllfkhs
    dfrdnfatslvtratklvvsqiftaanyeyclywvfmqdgairldirltgilntyilgdd
    eeagpwgtrvypnvnahnhqhlfslridpridgdgnsaaacdaksspyplgspenmygna
    fysekttfktvkdsltnyesatgrswdifnpnkvnpysgkppsyklvstqcppllakegs
    lvakrapwashsvnvvpykdnrlypsgdhvpqwsgdgvrgmrewigdgsenidntdilff
    htfgithfpapedfplmpaepitlmlrprhfftenpgldiqpsyamttseakrav
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2oovE (E:)
    aasaaparpahpldplstaeikaatntvksyfagkkisfntvtlreparkayiqwkeqgg
    plpprlayyvileagkpgvkeglvdlaslsvietraletvqpiltvedlcsteevirndp
    avieqcvlsgipanemhkvycdpwtigyderwgtgkrlqqalvyyrsdeddsqyshpldf
    cpivdteekkvifidipnrrrkvskhkhanfypkhmiekvgamrpeappinvtqpegvsf
    kmtgnvmewsnfkfhigfnyregivlsdvsyndhgnvrpifhrislsemivpygspefph
    qrkhaldigeygagymtnplslgcdckgvihyldahfsdragdpitvknavciheeddgl
    lfkhsdfrdnfatslvtratklvvsqiftaanyeyclywvfmqdgairldirltgilnty
    ilgddeeagpwgtrvypnvnahnhqhlfslridpridgdgnsaaacdaksspyplgspen
    mygnafysekttfktvkdsltnyesatgrswdifnpnkvnpysgkppsyklvstqcppll
    akegslvakrapwashsvnvvpykdnrlypsgdhvpqwsgdgvrgmrewigdgsenidnt
    dilffhtfgithfpapedfplmpaepitlmlrprhfftenpgldiqpsyamttseakrav
    

    Sequence, based on observed residues (ATOM records): (download)
    >2oovE (E:)
    parpahpldplstaeikaatntvksyfagkkisfntvtlreparkayiqwkeqggplppr
    layyvileagkpgvkeglvdlaslsvietraletvqpiltvedlcsteevirndpavieq
    cvlsgipanemhkvycdpwtigyderwgtgkrlqqalvyyrsdeddsqyshpldfcpivd
    teekkvifidipnrrrkvskhkhanfypkhmiekvgamrpeappinvtqpegvsfkmtgn
    vmewsnfkfhigfnyregivlsdvsyndhgnvrpifhrislsemivpygspefphqrkha
    ldigeygagymtnplslgcdckgvihyldahfsdragdpitvknavciheeddgllfkhs
    dfrdnfatslvtratklvvsqiftaanyeyclywvfmqdgairldirltgilntyilgdd
    eeagpwgtrvypnvnahnhqhlfslridpridgdgnsaaacdaksspyplgspenmygna
    fysekttfktvkdsltnyesatgrswdifnpnkvnpysgkppsyklvstqcppllakegs
    lvakrapwashsvnvvpykdnrlypsgdhvpqwsgdgvrgmrewigdgsenidntdilff
    htfgithfpapedfplmpaepitlmlrprhfftenpgldiqpsyamttseakrav
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2oovF (F:)
    aasaaparpahpldplstaeikaatntvksyfagkkisfntvtlreparkayiqwkeqgg
    plpprlayyvileagkpgvkeglvdlaslsvietraletvqpiltvedlcsteevirndp
    avieqcvlsgipanemhkvycdpwtigyderwgtgkrlqqalvyyrsdeddsqyshpldf
    cpivdteekkvifidipnrrrkvskhkhanfypkhmiekvgamrpeappinvtqpegvsf
    kmtgnvmewsnfkfhigfnyregivlsdvsyndhgnvrpifhrislsemivpygspefph
    qrkhaldigeygagymtnplslgcdckgvihyldahfsdragdpitvknavciheeddgl
    lfkhsdfrdnfatslvtratklvvsqiftaanyeyclywvfmqdgairldirltgilnty
    ilgddeeagpwgtrvypnvnahnhqhlfslridpridgdgnsaaacdaksspyplgspen
    mygnafysekttfktvkdsltnyesatgrswdifnpnkvnpysgkppsyklvstqcppll
    akegslvakrapwashsvnvvpykdnrlypsgdhvpqwsgdgvrgmrewigdgsenidnt
    dilffhtfgithfpapedfplmpaepitlmlrprhfftenpgldiqpsyamttseakrav
    

    Sequence, based on observed residues (ATOM records): (download)
    >2oovF (F:)
    parpahpldplstaeikaatntvksyfagkkisfntvtlreparkayiqwkeqggplppr
    layyvileagkpgvkeglvdlaslsvietraletvqpiltvedlcsteevirndpavieq
    cvlsgipanemhkvycdpwtigyderwgtgkrlqqalvyyrsdeddsqyshpldfcpivd
    teekkvifidipnrrrkvskhkhanfypkhmiekvgamrpeappinvtqpegvsfkmtgn
    vmewsnfkfhigfnyregivlsdvsyndhgnvrpifhrislsemivpygspefphqrkha
    ldigeygagymtnplslgcdckgvihyldahfsdragdpitvknavciheeddgllfkhs
    dfrdnfatslvtratklvvsqiftaanyeyclywvfmqdgairldirltgilntyilgdd
    eeagpwgtrvypnvnahnhqhlfslridpridgdgnsaaacdaksspyplgspenmygna
    fysekttfktvkdsltnyesatgrswdifnpnkvnpysgkppsyklvstqcppllakegs
    lvakrapwashsvnvvpykdnrlypsgdhvpqwsgdgvrgmrewigdgsenidntdilff
    htfgithfpapedfplmpaepitlmlrprhfftenpgldiqpsyamttseakrav