PDB entry 2oon

View 2oon on RCSB PDB site
Description: Structure of Ala14-PYY in aqueous solution
Class: hormone
Keywords: peptide YY, PYY, neurohormone, folding of helical hairpins, NMR
Deposited on 2007-01-26, released 2007-12-25
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peptide YY
    Species: Sus scrofa [TaxId:9823]
    Gene: PYY
    Database cross-references and differences (RAF-indexed):
    • Uniprot P68005 (0-35)
      • engineered (13)
    Domains in SCOPe 2.05: d2oona1

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2oonA (A:)
    ypakpeapgedasaeelsryyaslrhylnlvtrqry