PDB entry 2ook

View 2ook on RCSB PDB site
Description: Crystal structure of a protein with unknown function (YP_749275.1) from Shewanella Frigidimarina NCIMB 400 at 1.80 A resolution
Class: structural genomics, unknown function
Keywords: YP_749275.1, hypothetical protein, Structural Genomics, Joint Center for Structural Genomics, JCSG, Protein Structure Initiative, PSI-2, UNKNOWN FUNCTION
Deposited on 2007-01-25, released 2007-02-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein
    Species: Shewanella frigidimarina [TaxId:318167]
    Gene: YP_749275.1, Sfri_0576
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q087X8 (Start-126)
      • modified residue (3)
      • modified residue (40)
    Domains in SCOPe 2.07: d2ooka1
  • Chain 'B':
    Compound: hypothetical protein
    Species: Shewanella frigidimarina [TaxId:318167]
    Gene: YP_749275.1, Sfri_0576
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q087X8 (Start-126)
      • modified residue (3)
      • modified residue (40)
    Domains in SCOPe 2.07: d2ookb_
  • Heterogens: EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ookA (A:)
    gmdmkkhglsiginriesvffvtlkaigtlthedylvitpmlegalsqvdqpkvslflda
    teldgwdlraawddlklglkhksefervailgnkdwqewaakigswfiageikyfededd
    alkwlry
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ookA (A:)
    dmkkhglsiginriesvffvtlkaigtlthedylvitpmlegalsqvdqpkvslfldate
    ldgwdlraawddlklglkhksefervailgnkdwqewaakigswfiageikyfededdal
    kwlry
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2ookB (B:)
    gmdmkkhglsiginriesvffvtlkaigtlthedylvitpmlegalsqvdqpkvslflda
    teldgwdlraawddlklglkhksefervailgnkdwqewaakigswfiageikyfededd
    alkwlry
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ookB (B:)
    mkkhglsiginriesvffvtlkaigtlthedylvitpmlegalsqvdqpkvslfldatel
    dgwdlraawddlklglksefervailgnkdwqewaakigswfiageikyfededdalkwl
    ry