PDB entry 2ooh

View 2ooh on RCSB PDB site
Description: Crystal Structure of MIF bound to a Novel Inhibitor, OXIM-11
Class: isomerase
Keywords: alternative ligand-binding modes, ISOMERASE
Deposited on 2007-01-25, released 2007-06-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: macrophage migration inhibitory factor
    Species: Homo sapiens [TaxId:9606]
    Gene: MIF
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ooha_
  • Chain 'B':
    Compound: macrophage migration inhibitory factor
    Species: Homo sapiens [TaxId:9606]
    Gene: MIF
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2oohb_
  • Chain 'C':
    Compound: macrophage migration inhibitory factor
    Species: Homo sapiens [TaxId:9606]
    Gene: MIF
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2oohc_
  • Heterogens: SO4, OX3, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2oohA (A:)
    pmfivntnvprasvpdgflseltqqlaqatgkppqyiavhvvpdqlmafggssepcalcs
    lhsigkiggaqnrsyskllcgllaerlrispdrvyinyydmnaanvgwnnstfa
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2oohB (B:)
    pmfivntnvprasvpdgflseltqqlaqatgkppqyiavhvvpdqlmafggssepcalcs
    lhsigkiggaqnrsyskllcgllaerlrispdrvyinyydmnaanvgwnnstfa
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2oohC (C:)
    pmfivntnvprasvpdgflseltqqlaqatgkppqyiavhvvpdqlmafggssepcalcs
    lhsigkiggaqnrsyskllcgllaerlrispdrvyinyydmnaanvgwnnstfa