PDB entry 2ood

View 2ood on RCSB PDB site
Description: Crystal structure of guanine deaminase from Bradyrhizobium japonicum
Class: hydrolase
Keywords: PSI-II, PSI-2, 9231a, guanine deaminase, guanine, Structural Genomics, Protein Structure Initiative, New York SGX Research Center for Structural Genomics, NYSGXRC, HYDROLASE
Deposited on 2007-01-25, released 2007-02-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.62 Å
R-factor: 0.186
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Blr3880 protein
    Species: Bradyrhizobium japonicum [TaxId:224911]
    Gene: bII3846, blr3880
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q89NG0 (3-466)
      • cloning artifact (2)
      • modified residue (37)
      • modified residue (157)
      • modified residue (284)
      • modified residue (320)
      • modified residue (334)
      • modified residue (346)
      • modified residue (439)
      • modified residue (444-445)
      • modified residue (458)
    Domains in SCOPe 2.07: d2ooda1, d2ooda2, d2ooda3
  • Heterogens: ZN, GUN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2oodA (A:)
    mslttvgirgtffdfvddpwkhigneqaaarfhqdglmvvtdgvikafgpyekiaaahpg
    veithikdriivpgfidghihlpqtrvlgaygeqllpwlqksiypeeikykdrnyaregv
    krfldallaagtttcqaftssspvateelfeeasrrnmrviagltgidrnapaefidtpe
    nfyrdskrliaqyhdkgrnlyaitprfafgaspellkacqrlkhehpdcwvnthisenpa
    ecsgvlvehpdcqdylgvyekfdlvgpkfsgghgvylsnnefrrmskkgaavvfcpcsnl
    flgsglfrlgratdpehrvkmsfgtdvgggnrfsmisvlddaykvgmcnntlldgsidps
    rkdlaeaernklspyrgfwsvtlggaeglyiddklgnfepgkeadfvaldpnggqlaqpw
    hqsliadgagprtvdeaasmlfavmmvgddrcvdetwvmgkrlykkseghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2oodA (A:)
    lttvgirgtffdfvddpwkhigneqaaarfhqdglmvvtdgvikafgpyekiaaahpgve
    ithikdriivpgfidghihlpqtrvlgaygeqllpwlqksiypeeikykdrnyaregvkr
    fldallaagtttcqaftssspvateelfeeasrrnmrviagltgidrnapaefidtpenf
    yrdskrliaqyhdkgrnlyaitprfafgaspellkacqrlkhehpdcwvnthisenpaec
    sgvlvehpdcqdylgvyekfdlvgpkfsgghgvylsnnefrrmskkgaavvfcpcsnlfl
    gsglfrlgratdpehrvkmsfgtdvgggnrfsmisvlddaykvgmcnntlldgsidpsrk
    dlaeaernklspyrgfwsvtlggaeglyiddklgnfepgkeadfvaldpnggqlaqpwhq
    sligagprtvdeaasmlfavmmvgddrcvdetwvmgkrlykks