PDB entry 2oo8

View 2oo8 on RCSB PDB site
Description: Synthesis, Structural Analysis, and SAR Studies of Triazine Derivatives as Potent, Selective Tie-2 Inhibitors
Class: transferase
Keywords: Kinase, TRANSFERASE
Deposited on 2007-01-25, released 2007-03-20
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.235
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'X':
    Compound: Angiopoietin-1 receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: TEK, TIE2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2oo8x_
  • Heterogens: RAJ, HOH

PDB Chain Sequences:

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >2oo8X (X:)
    knnpdptiypvldwndikfqdvigegnfgqvlkarikkdglrmdaaikrmkeyaskddhr
    dfagelevlcklghhpniinllgacehrgylylaieyaphgnlldflrksrvletdpafa
    ianstastlssqqllhfaadvargmdylsqkqfihrdlaarnilvgenyvakiadfglsr
    gqevyvkktmgrlpvrwmaieslnysvyttnsdvwsygvllweivslggtpycgmtcael
    yeklpqgyrlekplncddevydlmrqcwrekpyerpsfaqilvslnrmleerktyvnttl
    yekftyagidcsaeeaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >2oo8X (X:)
    gqvlkarirmdaaikrmkekddhrdfagelevlcklghhpniinllgacehylaieyaph
    gnlldflrksrvletdpafaianstastlssqqllhfaadvargmdylsqkqfihrdlaa
    rnilvgenyvakiadfglmgrlpvrwmaieslnysvyttnsdvwsygvllweivslggtp
    ycgmtcaelyeklpqgyrlekplncddevydlmrqcwrekpyerpsfaqilvslnrmlee
    rktyvnttlyekftyagid