PDB entry 2oo5

View 2oo5 on RCSB PDB site
Description: Structure of transhydrogenase (dI.H2NADH)2(dIII.NADP+)1 asymmetric complex
Class: oxidoreductase
Keywords: Rossmann fold; NAD(H)-binding site; NADP(H)-binding site, OXIDOREDUCTASE
Deposited on 2007-01-25, released 2007-03-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.222
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: NAD(P) transhydrogenase subunit alpha part 1
    Species: Rhodospirillum rubrum [TaxId:1085]
    Gene: pntAA, nntA1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2oo5a1, d2oo5a2
  • Chain 'B':
    Compound: NAD(P) transhydrogenase subunit alpha part 1
    Species: Rhodospirillum rubrum [TaxId:1085]
    Gene: pntAA, nntA1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2oo5b1, d2oo5b2
  • Chain 'C':
    Compound: NAD(P) transhydrogenase subunit beta
    Species: Rhodospirillum rubrum [TaxId:1085]
    Gene: pntB, nntB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2oo5c_
  • Heterogens: SO4, NAP, TXD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2oo5A (A:)
    mkiaipkerrpgedrvaispevvkklvglgfeviveqgagvgasitddaltaagatiast
    aaqalsqadvvwkvqrpmtaeegtdevalikegavlmchlgaltnrpvvealtkrkitay
    amelmprisraqsmdilssqsnlagyravidgayefarafpmmmtaagtvpparvlvfgv
    gvaglqaiatakrlgavvmatdvraatkeqveslggkfitvddeamktaetaggyakemg
    eefrkkqaeavlkelvktdiaittalipgkpapvliteemvtkmkpgsviidlaveaggn
    cplsepgkivvkhgvkivghtnvpsrvaadasplfaknllnfltphvdkdtktlvmkled
    etvsgtcvtrdgaivhpaltgqga
    

    Sequence, based on observed residues (ATOM records): (download)
    >2oo5A (A:)
    mkiaipkerrpgedrvaispevvkklvglgfeviveqgagvgasitddaltaagatiast
    aaqalsqadvvwkvqrpmtaeegtdevalikegavlmchlgaltnrpvvealtkrkitay
    amelmprisraqsmdilssqsnlagyravidgayefarafpmmmtaagtvpparvlvfgv
    gvaglqaiatakrlgavvmatdvraatkeqveslggkfitvddeamktaetaggyakemg
    eefrkkqaeavlkelvktdiaittalipgkpapvliteemvtkmkpgsviidlaveaggn
    cplsepgkivvkhgvkivghtnvpsrvaadasplfaknllnfltphvdkdtktlvmkled
    etvsgtcvtrdgaivhpalt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2oo5B (B:)
    mkiaipkerrpgedrvaispevvkklvglgfeviveqgagvgasitddaltaagatiast
    aaqalsqadvvwkvqrpmtaeegtdevalikegavlmchlgaltnrpvvealtkrkitay
    amelmprisraqsmdilssqsnlagyravidgayefarafpmmmtaagtvpparvlvfgv
    gvaglqaiatakrlgavvmatdvraatkeqveslggkfitvddeamktaetaggyakemg
    eefrkkqaeavlkelvktdiaittalipgkpapvliteemvtkmkpgsviidlaveaggn
    cplsepgkivvkhgvkivghtnvpsrvaadasplfaknllnfltphvdkdtktlvmkled
    etvsgtcvtrdgaivhpaltgqga
    

    Sequence, based on observed residues (ATOM records): (download)
    >2oo5B (B:)
    mkiaipkerrpgedrvaispevvkklvglgfeviveqgagvgasitddaltaagatiast
    aaqalsqadvvwkvqrpmtaeegtdevalikegavlmchlgaltnrpvvealtkrkitay
    amelmprisraqsmdilssqsnlagyravidgayefarafpmmmtaagtvpparvlvfgv
    gvaglqaiatakrlgavvmatdvraatkeqveslggkfitvddeamktaetaggyakemg
    eefrkkqaeavlkelvktdiaittalipgkpapvliteemvtkmkpgsviidlaveaggn
    cplsepgkivvkhgvkivghtnvpsrvaadasplfaknllnfltphvdkdtktlvmkled
    etvsgtcvtrdgaivhpalt
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2oo5C (C:)
    svkagsaedaafimknaskviivpgygmavaqaqhalremadvlkkegvevsyaihpvag
    rmpghmnvllaeanvpydevfeleeinssfqtadvafvigandvtnpaaktdpsspiygm
    pildvekagtvlfikrsmasgyagvenelffrnntmmlfgdakkmteqivqamn