PDB entry 2ony

View 2ony on RCSB PDB site
Description: Structure of hPNMT with inhibitor 7-(N-4-chlorophenylaminosulfonyl)-THIQ and AdoHcy
Class: Transferase
Keywords: methyltransferase, Transferase
Deposited on 2007-01-24, released 2007-10-09
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.223
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phenylethanolamine N-methyltransferase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2onya_
  • Chain 'B':
    Compound: Phenylethanolamine N-methyltransferase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2onyb2, d2onyb3
  • Heterogens: PO4, SAH, TMJ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2onyA (A:)
    msgadrspnagaapdsapgqaavasayqrfepraylrnnyapprgdlcnpngvgpwklrc
    laqtfatgevsgrtlidigsgptvyqllsacshfeditmtdflevnrqelgrwlqeepga
    fnwsmysqhacliegkgecwqdkerqlrarvkrvlpidvhqpqplgagspaplpadalvs
    afcleavspdlasfqraldhittllrpgghllligaleeswylagearltvvpvseeevr
    ealvrsgykvrdlrtyimpahlqtgvddvkgvffawaqkvglehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2onyA (A:)
    asayqrfepraylrnnyapprgdlcnpngvgpwklrclaqtfatgevsgrtlidigsgpt
    vyqllsacshfeditmtdflevnrqelgrwlqeepgafnwsmysqhacliegkgecwqdk
    erqlrarvkrvlpidvhqpqplgagspaplpadalvsafcleavspdlasfqraldhitt
    llrpgghllligaleeswylagearltvvpvseeevrealvrsgykvrdlrtyimpahlq
    tgvddvkgvffawaqkv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2onyB (B:)
    msgadrspnagaapdsapgqaavasayqrfepraylrnnyapprgdlcnpngvgpwklrc
    laqtfatgevsgrtlidigsgptvyqllsacshfeditmtdflevnrqelgrwlqeepga
    fnwsmysqhacliegkgecwqdkerqlrarvkrvlpidvhqpqplgagspaplpadalvs
    afcleavspdlasfqraldhittllrpgghllligaleeswylagearltvvpvseeevr
    ealvrsgykvrdlrtyimpahlqtgvddvkgvffawaqkvglehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2onyB (B:)
    pdsapgqaavasayqrfepraylrnnyapprgdlcnpngvgpwklrclaqtfatgevsgr
    tlidigsgptvyqllsacshfeditmtdflevnrqelgrwlqeepgafnwsmysqhacli
    egkgecwqdkerqlrarvkrvlpidvhqpqplgagspaplpadalvsafcleavspdlas
    fqraldhittllrpgghllligaleeswylagearltvvpvseeevrealvrsgykvrdl
    rtyimpahlqtgvddvkgvffawaqkvg