PDB entry 2onu

View 2onu on RCSB PDB site
Description: Plasmodium falciparum ubiquitin conjugating enzyme PF10_0330, putative homologue of human UBE2H
Class: ligase
Keywords: Ubiquitin-conjugating enzyme; UBC; Ubiquitin; Plasmodium falciparum; Structural Genomics Consortium; SGC, LIGASE
Deposited on 2007-01-24, released 2007-02-06
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.38 Å
R-factor: 0.215
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ubiquitin-conjugating enzyme, putative
    Species: PLASMODIUM FALCIPARUM [TaxId:36329]
    Gene: PF10_0330
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2onua_
  • Heterogens: PG4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2onuA (A:)
    gtsltrkqcdftklimagydlelnngstqdfdvmfhgpngtayeggiwkvhvtlpddypf
    aspsigfmnkllhpnvdeasgsvcldvinqtwtplyslvnvfevflpqlltypnpsdpln
    sdaasllmkdkniyeekvkeyvklyaskdlwe
    

    Sequence, based on observed residues (ATOM records): (download)
    >2onuA (A:)
    sltrkqcdftklimagydlelnngstqdfdvmfhgpngtayeggiwkvhvtlpddypfas
    psigfmnkllhpnvdeasgsvcldvinqtwtplyslvnvfevflpqlltypnpsdplnsd
    aasllmkdkniyeekvkeyvklyaskdlwe