PDB entry 2onq

View 2onq on RCSB PDB site
Description: Gbeta1 stabilization by in vitro evolution and computational design
Class: protein binding
Keywords: beta sheet, alpha helix, improved hydrophobic packing of core residues, PROTEIN BINDING
Deposited on 2007-01-24, released 2008-01-08
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.206
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Immunoglobulin G-binding protein G
    Species: Streptococcus sp. [TaxId:1324]
    Gene: spg
    Database cross-references and differences (RAF-indexed):
    • Uniprot P19909 (1-55)
      • initiating methionine (0)
      • engineered (1-2)
      • engineered (5)
      • engineered (15)
      • engineered (17)
      • engineered (24)
      • engineered (28)
      • engineered (38)
    Domains in SCOPe 2.01: d2onqa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2onqA (A:)
    mqfkliingktlkgeitieavdaaeaekffkqyandngidgewtyddatktftvte