PDB entry 2onj

View 2onj on RCSB PDB site
Description: Structure of the multidrug ABC transporter Sav1866 from S. aureus in complex with AMP-PNP
Class: hydrolase
Keywords: integral membrane protein, transport protein, HYDROLASE
Deposited on 2007-01-24, released 2007-03-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3.4 Å
R-factor: 0.254
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Multidrug export ATP-binding/permease protein SAV1866
    Species: Staphylococcus aureus [TaxId:1280]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2onja1, d2onja2
  • Chain 'B':
    Compound: Multidrug export ATP-binding/permease protein SAV1866
    Species: Staphylococcus aureus [TaxId:1280]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2onjb1, d2onjb2
  • Heterogens: NA, ANP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2onjA (A:)
    mikrylqfvkpykyrifatiivgiikfgipmlipllikyaidgvinnhalttdekvhhlt
    iaigialfifvivrppiefirqylaqwtsnkilydirkklynhlqalsarfyannqvgqv
    isrvindveqtkdfiltglmniwldcitiiialsimffldvkltlaalfifpfyiltvyv
    ffgrlrkltrersqalaevqgflhervqgisvvksfaiedneaknfdkkntnfltralkh
    trwnaysfaaintvtdigpiivigvgaylaisgsitvgtlaafvgylellfgplrrlvas
    fttltqsfasmdrvfqlidedydikngvgaqpieikqgrididhvsfqyndneapilkdi
    nlsiekgetvafvgmsgggkstlinliprfydvtsgqilidghnikdfltgslrnqiglv
    qqdnilfsdtvkenillgrptatdeevveaakmanahdfimnlpqgydtevgergvklsg
    gqkqrlsiariflnnppilildeatsaldlesesiiqealdvlskdrttlivahrlstit
    hadkivvienghivetgthreliakqgayehlysiqnl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2onjB (B:)
    mikrylqfvkpykyrifatiivgiikfgipmlipllikyaidgvinnhalttdekvhhlt
    iaigialfifvivrppiefirqylaqwtsnkilydirkklynhlqalsarfyannqvgqv
    isrvindveqtkdfiltglmniwldcitiiialsimffldvkltlaalfifpfyiltvyv
    ffgrlrkltrersqalaevqgflhervqgisvvksfaiedneaknfdkkntnfltralkh
    trwnaysfaaintvtdigpiivigvgaylaisgsitvgtlaafvgylellfgplrrlvas
    fttltqsfasmdrvfqlidedydikngvgaqpieikqgrididhvsfqyndneapilkdi
    nlsiekgetvafvgmsgggkstlinliprfydvtsgqilidghnikdfltgslrnqiglv
    qqdnilfsdtvkenillgrptatdeevveaakmanahdfimnlpqgydtevgergvklsg
    gqkqrlsiariflnnppilildeatsaldlesesiiqealdvlskdrttlivahrlstit
    hadkivvienghivetgthreliakqgayehlysiqnl