PDB entry 2onf

View 2onf on RCSB PDB site
Description: Crystal structure of a putative osmotically inducible protein c (ta0195) from thermoplasma acidophilum at 1.70 A resolution
Class: oxidoreductase
Keywords: Structural genomics, Joint Center for Structural Genomics, JCSG, Protein Structure Initiative, PSI-2, oxidoreductase
Deposited on 2007-01-23, released 2007-02-06
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.164
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Hypothetical protein Ta0195
  Species: Thermoplasma acidophilum [TaxId:2303]
  Gene: NP_393673.1, Ta0195
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9HLN2 (1-139)
    • leader sequence (0)
    • modified residue (1)
    • modified residue (65)
    • modified residue (113)
  Domains in SCOPe 2.01: d2onfa1
• Chain 'B':
  Compound: Hypothetical protein Ta0195
  Species: Thermoplasma acidophilum [TaxId:2303]
  Gene: NP_393673.1, Ta0195
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9HLN2 (1-139)
    • leader sequence (0)
    • modified residue (1)
    • modified residue (65)
    • modified residue (113)
  Domains in SCOPe 2.01: d2onfb_
• Heterogens: COA, EDO, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2onfA (A:)
  gmhvyesdvswiddrrtevsvgdhrievdsppefggpegqlypetlfpsvlascllttfl
  efkdrmginlkswnshvtaelgpspekgfkfhrikihvkigvndedkekipramqlaeky
  cfisrairnnveeivdyefv
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2onfB (B:)
  gmhvyesdvswiddrrtevsvgdhrievdsppefggpegqlypetlfpsvlascllttfl
  efkdrmginlkswnshvtaelgpspekgfkfhrikihvkigvndedkekipramqlaeky
  cfisrairnnveeivdyefv