PDB entry 2one

View 2one on RCSB PDB site
Description: asymmetric yeast enolase dimer complexed with resolved 2'-phosphoglycerate and phosphoenolpyruvate
Deposited on 1997-09-08, released 1998-01-14
The last revision prior to the SCOP 1.55 freeze date was dated 1998-01-14, with a file datestamp of 1998-01-14.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.137
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2oneA (A:)
    avskvyarsvydsrgnptvevelttekgvfrsivpsgastgvhealemrdgdkskwmgkg
    vlhavknvndviapafvkanidvkdqkavddflisldgtanksklganailgvslaasra
    aaaeknvplykhladlsksktspyvlpvpflnvlnggshaggalalqefmiaptgaktfa
    ealrigsevyhnlksltkkrygasagnvgdeggvapniqtaeealdlivdaikaaghdgk
    vkigldcasseffkdgkydldfknpnsdkskwltgpqladlyhslmkrypivsiedpfae
    ddweawshffktagiqivaddltvtnpkriataiekkaadalllkvnqigtlsesikaaq
    dsfaagwgvmvshrsgetedtfiadlvvglrtgqiktgaparserlaklnqllrieeelg
    dnavfagenfhhgdkl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2oneB (B:)
    avskvyarsvydsrgnptvevelttekgvfrsivpsgastgvhealemrdgdkskwmgkg
    vlhavknvndviapafvkanidvkdqkavddflisldgtanksklganailgvslaasra
    aaaeknvplykhladlsksktspyvlpvpflnvlnggshaggalalqefmiaptgaktfa
    ealrigsevyhnlksltkkrygasagnvgdeggvapniqtaeealdlivdaikaaghdgk
    vkigldcasseffkdgkydldfknpnsdkskwltgpqladlyhslmkrypivsiedpfae
    ddweawshffktagiqivaddltvtnpkriataiekkaadalllkvnqigtlsesikaaq
    dsfaagwgvmvshrsgetedtfiadlvvglrtgqiktgaparserlaklnqllrieeelg
    dnavfagenfhhgdkl