PDB entry 2onc

View 2onc on RCSB PDB site
Description: Crystal structure of human DPP-4
Class: hydrolase
Keywords: DPP4 protein-inhibitor complex, HYDROLASE
Deposited on 2007-01-23, released 2008-03-04
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.55 Å
R-factor: 0.198
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dipeptidyl peptidase 4
    Species: Homo sapiens [TaxId:9606]
    Gene: DPP4, ADCP2, CD26
    Database cross-references and differences (RAF-indexed):
    • Uniprot P27487 (5-730)
      • expression tag (4)
    Domains in SCOPe 2.06: d2onca1, d2onca2, d2onca3
  • Chain 'B':
    Compound: dipeptidyl peptidase 4
    Species: Homo sapiens [TaxId:9606]
    Gene: DPP4, ADCP2, CD26
    Database cross-references and differences (RAF-indexed):
    • Uniprot P27487 (5-730)
      • expression tag (0-4)
    Domains in SCOPe 2.06: d2oncb1, d2oncb2, d2oncb3
  • Chain 'C':
    Compound: dipeptidyl peptidase 4
    Species: Homo sapiens [TaxId:9606]
    Gene: DPP4, ADCP2, CD26
    Database cross-references and differences (RAF-indexed):
    • Uniprot P27487 (5-730)
      • expression tag (4)
    Domains in SCOPe 2.06: d2oncc1, d2oncc2, d2oncc3
  • Chain 'D':
    Compound: dipeptidyl peptidase 4
    Species: Homo sapiens [TaxId:9606]
    Gene: DPP4, ADCP2, CD26
    Database cross-references and differences (RAF-indexed):
    • Uniprot P27487 (5-730)
      • expression tag (4)
    Domains in SCOPe 2.06: d2oncd1, d2oncd2, d2oncd3
  • Heterogens: NAG, SY1, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2oncA (A:)
    hhasaktytltdylkntyrlklyslrwisdheylykqennilvfnaeygnssvflenstf
    defghsindysispdgqfilleynyvkqwrhsytasydiydlnkrqliteeripnntqwv
    twspvghklayvwnndiyvkiepnlpsyritwtgkediiyngitdwvyeeevfsaysalw
    wspngtflayaqfndtevplieysfysdeslqypktvrvpypkagavnptvkffvvntds
    lssvtnatsiqitapasmligdhylcdvtwatqerislqwlrriqnysvmdicdydessg
    rwnclvarqhiemsttgwvgrfrpsephftldgnsfykiisneegyrhicyfqidkkdct
    fitkgtwevigiealtsdylyyisneykgmpggrnlykiqlsdytkvtclscelnpercq
    yysvsfskeakyyqlrcsgpglplytlhssvndkglrvlednsaldkmlqnvqmpskkld
    fiilnetkfwyqmilpphfdkskkypllldvyagpcsqkadtvfrlnwatylasteniiv
    asfdgrgsgyqgdkimhainrrlgtfevedqieaarqfskmgfvdnkriaiwgwsyggyv
    tsmvlgsgsgvfkcgiavapvsrweyydsvyterymglptpednldhyrnstvmsraenf
    kqveyllihgtaddnvhfqqsaqiskalvdvgvdfqamwytdedhgiasstahqhiythm
    shfikqcfslp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2oncA (A:)
    aktytltdylkntyrlklyslrwisdheylyknilvfnaeygnssvflenstfdefghsi
    ndysispdgqfilleynyvkqwrhsytasydiydlnkrqliteeripnntqwvtwspvgh
    klayvwnndiyvkiepnlpsyritwtgkediiyngitdwvyeeevfsaysalwwspngtf
    layaqfndtevplieysfysdeslqypktvrvpypkagavnptvkffvvntdslssvtna
    tsiqitapasmligdhylcdvtwatqerislqwlrriqnysvmdicdydessgrwnclva
    rqhiemsttgwvgrfrpsephftldgnsfykiisneegyrhicyfqidkkdctfitkgtw
    evigiealtsdylyyisneykgmpggrnlykiqlsdytkvtclscelnpercqyysvsfs
    keakyyqlrcsgpglplytlhssvndkglrvlednsaldkmlqnvqmpskkldfiilnet
    kfwyqmilpphfdkskkypllldvyagpcsqkadtvfrlnwatylasteniivasfdgrg
    sgyqgdkimhainrrlgtfevedqieaarqfskmgfvdnkriaiwgwsyggyvtsmvlgs
    gsgvfkcgiavapvsrweyydsvyterymglptpednldhyrnstvmsraenfkqveyll
    ihgtaddnvhfqqsaqiskalvdvgvdfqamwytdedhgiasstahqhiythmshfikqc
    fslp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2oncB (B:)
    hhasaktytltdylkntyrlklyslrwisdheylykqennilvfnaeygnssvflenstf
    defghsindysispdgqfilleynyvkqwrhsytasydiydlnkrqliteeripnntqwv
    twspvghklayvwnndiyvkiepnlpsyritwtgkediiyngitdwvyeeevfsaysalw
    wspngtflayaqfndtevplieysfysdeslqypktvrvpypkagavnptvkffvvntds
    lssvtnatsiqitapasmligdhylcdvtwatqerislqwlrriqnysvmdicdydessg
    rwnclvarqhiemsttgwvgrfrpsephftldgnsfykiisneegyrhicyfqidkkdct
    fitkgtwevigiealtsdylyyisneykgmpggrnlykiqlsdytkvtclscelnpercq
    yysvsfskeakyyqlrcsgpglplytlhssvndkglrvlednsaldkmlqnvqmpskkld
    fiilnetkfwyqmilpphfdkskkypllldvyagpcsqkadtvfrlnwatylasteniiv
    asfdgrgsgyqgdkimhainrrlgtfevedqieaarqfskmgfvdnkriaiwgwsyggyv
    tsmvlgsgsgvfkcgiavapvsrweyydsvyterymglptpednldhyrnstvmsraenf
    kqveyllihgtaddnvhfqqsaqiskalvdvgvdfqamwytdedhgiasstahqhiythm
    shfikqcfslp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2oncB (B:)
    hhasaktytltdylkntyrlklyslrwisdheylyknilvfnaeygnssvflenstfdef
    ghsindysispdgqfilleynyvkqwrhsytasydiydlnkrqliteeripnntqwvtws
    pvghklayvwnndiyvkiepnlpsyritwtgkediiyngitdwvyeeevfsaysalwwsp
    ngtflayaqfndtevplieysfysdeslqypktvrvpypkagavnptvkffvvntdslss
    vtnatsiqitapasmligdhylcdvtwatqerislqwlrriqnysvmdicdydessgrwn
    clvarqhiemsttgwvgrfrpsephftldgnsfykiisneegyrhicyfqidkkdctfit
    kgtwevigiealtsdylyyisneykgmpggrnlykiqlsdytkvtclscelnpercqyys
    vsfskeakyyqlrcsgpglplytlhssvndkglrvlednsaldkmlqnvqmpskkldfii
    lnetkfwyqmilpphfdkskkypllldvyagpcsqkadtvfrlnwatylasteniivasf
    dgrgsgyqgdkimhainrrlgtfevedqieaarqfskmgfvdnkriaiwgwsyggyvtsm
    vlgsgsgvfkcgiavapvsrweyydsvyterymglptpednldhyrnstvmsraenfkqv
    eyllihgtaddnvhfqqsaqiskalvdvgvdfqamwytdedhgiasstahqhiythmshf
    ikqcfslp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2oncC (C:)
    hhasaktytltdylkntyrlklyslrwisdheylykqennilvfnaeygnssvflenstf
    defghsindysispdgqfilleynyvkqwrhsytasydiydlnkrqliteeripnntqwv
    twspvghklayvwnndiyvkiepnlpsyritwtgkediiyngitdwvyeeevfsaysalw
    wspngtflayaqfndtevplieysfysdeslqypktvrvpypkagavnptvkffvvntds
    lssvtnatsiqitapasmligdhylcdvtwatqerislqwlrriqnysvmdicdydessg
    rwnclvarqhiemsttgwvgrfrpsephftldgnsfykiisneegyrhicyfqidkkdct
    fitkgtwevigiealtsdylyyisneykgmpggrnlykiqlsdytkvtclscelnpercq
    yysvsfskeakyyqlrcsgpglplytlhssvndkglrvlednsaldkmlqnvqmpskkld
    fiilnetkfwyqmilpphfdkskkypllldvyagpcsqkadtvfrlnwatylasteniiv
    asfdgrgsgyqgdkimhainrrlgtfevedqieaarqfskmgfvdnkriaiwgwsyggyv
    tsmvlgsgsgvfkcgiavapvsrweyydsvyterymglptpednldhyrnstvmsraenf
    kqveyllihgtaddnvhfqqsaqiskalvdvgvdfqamwytdedhgiasstahqhiythm
    shfikqcfslp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2oncC (C:)
    aktytltdylkntyrlklyslrwisdheylyknnilvfnaeygnssvflenstfdefghs
    indysispdgqfilleynyvkqwrhsytasydiydlnkrqliteeripnntqwvtwspvg
    hklayvwnndiyvkiepnlpsyritwtgkediiyngitdwvyeeevfsaysalwwspngt
    flayaqfndtevplieysfysdeslqypktvrvpypkagavnptvkffvvntdslssvtn
    atsiqitapasmligdhylcdvtwatqerislqwlrriqnysvmdicdydessgrwnclv
    arqhiemsttgwvgrfrpsephftldgnsfykiisneegyrhicyfqidkctfitkgtwe
    vigiealtsdylyyisneykgmpggrnlykiqlsdytkvtclscelnpercqyysvsfsk
    eakyyqlrcsgpglplytlhssvndkglrvlednsaldkmlqnvqmpskkldfiilnetk
    fwyqmilpphfdkskkypllldvyagpcsqkadtvfrlnwatylasteniivasfdgrgs
    gyqgdkimhainrrlgtfevedqieaarqfskmgfvdnkriaiwgwsyggyvtsmvlgsg
    sgvfkcgiavapvsrweyydsvyterymglptpednldhyrnstvmsraenfkqveylli
    hgtaddnvhfqqsaqiskalvdvgvdfqamwytdedhgiasstahqhiythmshfikqcf
    slp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2oncD (D:)
    hhasaktytltdylkntyrlklyslrwisdheylykqennilvfnaeygnssvflenstf
    defghsindysispdgqfilleynyvkqwrhsytasydiydlnkrqliteeripnntqwv
    twspvghklayvwnndiyvkiepnlpsyritwtgkediiyngitdwvyeeevfsaysalw
    wspngtflayaqfndtevplieysfysdeslqypktvrvpypkagavnptvkffvvntds
    lssvtnatsiqitapasmligdhylcdvtwatqerislqwlrriqnysvmdicdydessg
    rwnclvarqhiemsttgwvgrfrpsephftldgnsfykiisneegyrhicyfqidkkdct
    fitkgtwevigiealtsdylyyisneykgmpggrnlykiqlsdytkvtclscelnpercq
    yysvsfskeakyyqlrcsgpglplytlhssvndkglrvlednsaldkmlqnvqmpskkld
    fiilnetkfwyqmilpphfdkskkypllldvyagpcsqkadtvfrlnwatylasteniiv
    asfdgrgsgyqgdkimhainrrlgtfevedqieaarqfskmgfvdnkriaiwgwsyggyv
    tsmvlgsgsgvfkcgiavapvsrweyydsvyterymglptpednldhyrnstvmsraenf
    kqveyllihgtaddnvhfqqsaqiskalvdvgvdfqamwytdedhgiasstahqhiythm
    shfikqcfslp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2oncD (D:)
    aktytltdylkntyrlklyslrwisdheylyknilvfnaeygnssvflenstfdefghsi
    ndysispdgqfilleynyvkqwrhsytasydiydlnkrqliteeripnntqwvtwspvgh
    klayvwnndiyvkiepnlpsyritwtgkediiyngitdwvyeeevfsaysalwwspngtf
    layaqfndtevplieysfysdeslqypktvrvpypkagavnptvkffvvntdslssvtna
    tsiqitapasmligdhylcdvtwatqerislqwlrriqnysvmdicdydessgrwnclva
    rqhiemsttgwvgrfrpsephftldgnsfykiisneegyrhicyfqiddctfitkgtwev
    igiealtsdylyyisneykgmpggrnlykiqlsdytkvtclscelnpercqyysvsfske
    akyyqlrcsgpglplytlhssvndkglrvlednsaldkmlqnvqmpskkldfiilnetkf
    wyqmilpphfdkskkypllldvyagpcsqkadtvfrlnwatylasteniivasfdgrgsg
    yqgdkimhainrrlgtfevedqieaarqfskmgfvdnkriaiwgwsyggyvtsmvlgsgs
    gvfkcgiavapvsrweyydsvyterymglptpednldhyrnstvmsraenfkqveyllih
    gtaddnvhfqqsaqiskalvdvgvdfqamwytdedhgiasstahqhiythmshfikqcfs
    lp