PDB entry 2omx

View 2omx on RCSB PDB site
Description: Crystal structure of InlA S192N G194S+S/hEC1 complex
Class: cell invasion/cell adhesion
Keywords: leucine-rich-repeat, invasion protein, IG-like domain, adhesion protein, CELL INVASION-CELL ADHESION COMPLEX
Deposited on 2007-01-23, released 2007-08-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Internalin-A
    Species: LISTERIA MONOCYTOGENES [TaxId:169963]
    Gene: inlA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P25146 (0-461)
      • engineered (156)
      • engineered (158-159)
    Domains in SCOPe 2.07: d2omxa1, d2omxa3
  • Chain 'B':
    Compound: epithelial-cadherin
    Species: Homo sapiens [TaxId:9606]
    Gene: CDH1, CDHE, UVO
    Database cross-references and differences (RAF-indexed):
    • Uniprot P12830 (5-107)
      • expression tag (1-4)
    Domains in SCOPe 2.07: d2omxb2, d2omxb3
  • Heterogens: CL, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2omxA (A:)
    atitqdtpinqiftdtalaekmktvlgktnvtdtvsqtdldqvttlqadrlgiksidgve
    ylnnltqinfsnnqltditplknltklvdilmnnnqiaditplanltnltgltlfnnqit
    didplknltnlnrlelssntisdisalsgltslqqlnfssnqvtdlkplanlttlerldi
    ssnkvsdisvlakltnlesliatnnqisditplgiltnldelslngnqlkdigtlasltn
    ltdldlannqisnlaplsgltkltelklganqisnisplagltaltnlelnenqledisp
    isnlknltyltlyfnnisdispvssltklqrlffynnkvsdvsslanltninwlsaghnq
    isdltplanltritqlglndqawtnapvnykanvsipntvknvtgaliapatisdggsyt
    epditwnlpsytnevsytfsqpvtigkgtttfsgtvtqplka
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2omxB (B:)
    gplgswvippiscpenekgpfpknlvqiksnkdkegkvfysitgqgadtppvgvfiiere
    tgwlkvtepldreriatytlfshavssngnavedpmeilitvtdqndn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2omxB (B:)
    plgswvippiscpenekgpfpknlvqiksnkdkegkvfysitgqgadtppvgvfiieret
    gwlkvtepldreriatytlfshavssngnavedpmeilitvtdqndn