PDB entry 2omv

View 2omv on RCSB PDB site
Description: Crystal structure of InlA S192N Y369S/hEC1 complex
Class: cell invasion/cell adhesion
Keywords: leucine-rich-repeat, invasion protein, IG-like domain, adhesion protein, CELL INVASION-CELL ADHESION COMPLEX
Deposited on 2007-01-23, released 2007-06-05
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.157
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Internalin-A
    Species: LISTERIA MONOCYTOGENES [TaxId:169963]
    Gene: inlA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P25146 (0-459)
      • engineered (156)
      • engineered (333)
      • cloning artifact (460)
    Domains in SCOPe 2.06: d2omva1, d2omva2, d2omva3
  • Chain 'B':
    Compound: epithelial-cadherin
    Species: Homo sapiens [TaxId:9606]
    Gene: CDH1, CDHE, UVO
    Database cross-references and differences (RAF-indexed):
    • Uniprot P12830 (5-End)
      • cloning artifact (1-4)
    Domains in SCOPe 2.06: d2omvb2, d2omvb3
  • Heterogens: CA, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2omvA (A:)
    atitqdtpinqiftdtalaekmktvlgktnvtdtvsqtdldqvttlqadrlgiksidgve
    ylnnltqinfsnnqltditplknltklvdilmnnnqiaditplanltnltgltlfnnqit
    didplknltnlnrlelssntisdisalsgltslqqlnfgnqvtdlkplanlttlerldis
    snkvsdisvlakltnlesliatnnqisditplgiltnldelslngnqlkdigtlasltnl
    tdldlannqisnlaplsgltkltelklganqisnisplagltaltnlelnenqledispi
    snlknltyltlyfnnisdispvssltklqrlffsnnkvsdvsslanltninwlsaghnqi
    sdltplanltritqlglndqawtnapvnykanvsipntvknvtgaliapatisdggsyte
    pditwnlpsytnevsytfsqpvtigkgtttfsgtvtqplka
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2omvB (B:)
    gplgswvippiscpenekgpfpknlvqiksnkdkegkvfysitgqgadtppvgvfiiere
    tgwlkvtepldreriatytlfshavssngnavedpmeilitvtdq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2omvB (B:)
    plgswvippiscpenekgpfpknlvqiksnkdkegkvfysitgqgadtppvgvfiieret
    gwlkvtepldreriatytlfshavssngnavedpmeilitvtd