PDB entry 2omn

View 2omn on RCSB PDB site
Description: Bence Jones KWR Protein- Immunoglobulin Light Chain Dimer, P4(3)2(1)2 Crystal Form
Class: Immune system
Keywords: Immunoglobulin Light Chain, Immune system
Deposited on 2007-01-22, released 2007-07-17
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.226
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Bence Jones KWR Protein - Immunoglobulin Light Chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2OMN (0-216)
    Domains in SCOPe 2.04: d2omna1, d2omna2
  • Chain 'B':
    Compound: Bence Jones KWR Protein - Immunoglobulin Light Chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2OMN (0-216)
    Domains in SCOPe 2.04: d2omnb1, d2omnb2
  • Heterogens: SO4, IPH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2omnA (A:)
    esalpqpasvsgspgqsitisctgtssdvggydlvswyqhhpggapkliiyevtnrpsgv
    sdrfsgsksgntasltisglqaedeadyycssyasgstprifgggtrltvlgqpkaapsv
    tlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaas
    sylsltpeqwkshrsyscqvthegstvektvaptecs
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2omnB (B:)
    esalpqpasvsgspgqsitisctgtssdvggydlvswyqhhpggapkliiyevtnrpsgv
    sdrfsgsksgntasltisglqaedeadyycssyasgstprifgggtrltvlgqpkaapsv
    tlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaas
    sylsltpeqwkshrsyscqvthegstvektvaptecs