PDB entry 2omb

View 2omb on RCSB PDB site
Description: Bence Jones KWR Protein- Immunoglobulin Light Chain Dimer, P3(1)21 Crystal Form
Class: Immune system
Keywords: Immunoglobulin Light Chain, Immune system
Deposited on 2007-01-21, released 2007-07-17
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.235
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Bence Jones KWR Protein - Immunoglobulin Light Chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2OMB (0-216)
    Domains in SCOPe 2.04: d2omba1, d2omba2
  • Chain 'B':
    Compound: Bence Jones KWR Protein - Immunoglobulin Light Chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2OMB (0-216)
    Domains in SCOPe 2.04: d2ombb1, d2ombb2
  • Chain 'C':
    Compound: Bence Jones KWR Protein - Immunoglobulin Light Chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2OMB (0-216)
    Domains in SCOPe 2.04: d2ombc1, d2ombc2
  • Chain 'D':
    Compound: Bence Jones KWR Protein - Immunoglobulin Light Chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2OMB (0-216)
    Domains in SCOPe 2.04: d2ombd1, d2ombd2
  • Heterogens: SO4, IPH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ombA (A:)
    esalpqpasvsgspgqsitisctgtssdvggydlvswyqhhpggapkliiyevtnrpsgv
    sdrfsgsksgntasltisglqaedeadyycssyasgstprifgggtrltvlgqpkaapsv
    tlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaas
    sylsltpeqwkshrsyscqvthegstvektvaptecs
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ombB (B:)
    esalpqpasvsgspgqsitisctgtssdvggydlvswyqhhpggapkliiyevtnrpsgv
    sdrfsgsksgntasltisglqaedeadyycssyasgstprifgggtrltvlgqpkaapsv
    tlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaas
    sylsltpeqwkshrsyscqvthegstvektvaptecs
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ombC (C:)
    esalpqpasvsgspgqsitisctgtssdvggydlvswyqhhpggapkliiyevtnrpsgv
    sdrfsgsksgntasltisglqaedeadyycssyasgstprifgggtrltvlgqpkaapsv
    tlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaas
    sylsltpeqwkshrsyscqvthegstvektvaptecs
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ombD (D:)
    esalpqpasvsgspgqsitisctgtssdvggydlvswyqhhpggapkliiyevtnrpsgv
    sdrfsgsksgntasltisglqaedeadyycssyasgstprifgggtrltvlgqpkaapsv
    tlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaas
    sylsltpeqwkshrsyscqvthegstvektvaptecs