PDB entry 2oma

View 2oma on RCSB PDB site
Description: Crystallographic analysis of a chemically modified triosephosphate isomerase from Trypanosoma cruzi with dithiobenzylamine (DTBA)
Class: isomerase
Keywords: Triosephosphate isomerase, Trypanosoma cruzi, protein interfaces, dithiobisbenzylamine, ISOMERASE
Deposited on 2007-01-21, released 2007-11-20
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.199
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: triosephosphate isomerase
    Species: Trypanosoma cruzi [TaxId:5693]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P52270 (0-249)
      • modified residue (116)
    Domains in SCOPe 2.01: d2omaa_
  • Chain 'B':
    Compound: triosephosphate isomerase
    Species: Trypanosoma cruzi [TaxId:5693]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P52270 (0-249)
      • modified residue (116)
    Domains in SCOPe 2.01: d2omab_
  • Heterogens: SO4, PGE, PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2omaA (A:)
    askpqpiaaanwkcngsesllvplietlnaatfdhdvqcvvaptflhipmtkarltnpkf
    qiaaqnaitrsgaftgevslqilkdygiswvvlghserrlyygetneivaekvaqacaag
    fhvivcvgetneereagrtaavvltqlaavaqklskeawsrvviayepvwaigtgkvatp
    qqaqevhellrrwvrsklgtdiaaqlrilyggsvtaknartlyqmrdingflvggaslkp
    efveiieatk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2omaB (B:)
    askpqpiaaanwkcngsesllvplietlnaatfdhdvqcvvaptflhipmtkarltnpkf
    qiaaqnaitrsgaftgevslqilkdygiswvvlghserrlyygetneivaekvaqacaag
    fhvivcvgetneereagrtaavvltqlaavaqklskeawsrvviayepvwaigtgkvatp
    qqaqevhellrrwvrsklgtdiaaqlrilyggsvtaknartlyqmrdingflvggaslkp
    efveiieatk