PDB entry 2om7

View 2om7 on RCSB PDB site
Description: Structural Basis for Interaction of the Ribosome with the Switch Regions of GTP-bound Elongation Factors
Class: ribosome
Keywords: RNA-Protein Complex, RIBOSOME
Deposited on 2007-01-21, released 2008-01-15
The last revision prior to the SCOPe 2.04 freeze date was dated 2014-03-12, with a file datestamp of 2014-03-07.
Experiment type: EM
Resolution: 7.3 Å
R-factor: N/A
AEROSPACI score: -0.08 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fragment of 16S rRNA (h14)
    Species: Thermus thermophilus [TaxId:274]
  • Chain 'B':
    Compound: Fragment of 16S rRNA (h15)
    Species: Thermus thermophilus [TaxId:274]
  • Chain 'C':
    Compound: Fragment of 16S rRNA (h44)
    Species: Thermus thermophilus [TaxId:274]
  • Chain 'D':
    Compound: 16S ribosomal RNA (H5)
    Species: Thermus thermophilus [TaxId:274]
  • Chain 'E':
    Compound: 30S ribosomal protein S12
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2om7e1
  • Chain 'F':
    Compound: Fragment of23S rRNA (H95)
    Species: Thermus thermophilus [TaxId:274]
  • Chain 'G':
    Compound: Fragment of23S rRNA (H68)
    Species: Thermus thermophilus [TaxId:274]
  • Chain 'H':
    Compound: Fragment of23S rRNA (H89)
    Species: Thermus thermophilus [TaxId:274]
  • Chain 'I':
    Compound: Fragment of23S rRNA (H42-44)
    Species: Thermus thermophilus [TaxId:274]
  • Chain 'J':
    Compound: Fragment of23S rRNA (H76)
    Species: Thermus thermophilus [TaxId:274]
  • Chain 'K':
    Compound: 50s ribosomal protein l1
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2om7k1
  • Chain 'L':
    Compound: Elongation factor G
    Species: Thermus thermophilus [TaxId:274]
    Gene: fusA, fus
    Database cross-references and differences (RAF-indexed):
  • Chain 'M':
    Compound: p/E-tRNA
    Species: Thermus thermophilus [TaxId:274]
  • Chain 'N':
    Compound: 30S ribosomal protein S2
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2om7n1

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2om7E (E:)
    mvalptinqlvrkgrekvrkkskvpalkgapfrrgvctvvrtvtpkkpnsalrkvakvrl
    tsgyevtayipgeghnlqehsvvlirggrvkdlpgvryhivrgvydaagvkdrkksrsky
    gtkkpkeaaktaakk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2om7E (E:)
    ptinqlvrkgrekvrkkskvpalkgapfrrgvctvvrtvtpkkpnsalrkvakvrltsgy
    evtayipgeghnlqehsvvlirggrvkdlpgvryhivrgvydaagvkdrkksrskygtkk
    pkeaa
    

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    No sequence available.

  • Chain 'J':
    No sequence available.

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >2om7K (K:)
    mpkhgkryrallekvdpnkvytideaarlvkelatakfdetvevhaklgidprrsdqnvr
    gtvslphglgkqvrvlaiakgekikeaeeagadyvggeeiiqkildgwmdfdavvatpdv
    mgavgsklgrilgprgllpnpkagtvgfnigeiireikagriefrndktgaihapvgkas
    fppekladnirafiraleahkpegakgtflrsvyvtttmgpsvrinphs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2om7K (K:)
    kvytideaartakfdetvevhaklgidprrsdqnvrgtvslphglgkqvrvlaiakgeki
    keaeeagadyvggeeiiqkildgwmdfvmgavgsklgrilgprglnpkagtvgfnigeii
    reikagriefrndktgaihapvgkasfppekladnirafiraleahkpegakgtflrsvy
    vtttmgpsvri
    

  • Chain 'L':
    No sequence available.

  • Chain 'M':
    No sequence available.

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >2om7N (N:)
    mpveitvkelleagvhfgherkrwnpkfaryiyaerngihiidlqktmeelertfrfied
    lamrggtilfvgtkkqaqdivrmeaeragmpyvnqrwlggmltnfktisqrvhrleelea
    lfaspeieerpkkeqvrlkhelerlqkylsgfrllkrlpdaifvvdptkeaiavrearkl
    fipvialadtdsdpdlvdyiipgnddairsiqlilsravdliiqarggvvepspsyalvq
    eaeatetpegesevea
    

    Sequence, based on observed residues (ATOM records): (download)
    >2om7N (N:)
    vkelleagvhfgherkrwnpkfaryiyaerngihiidlqktmeelertfrfiedlamrgg
    tilfvgtkkqaqdivrmeaeragmpyvnqrwlggmltnfktisqrvhrleelealfaspe
    ieerpkkeqvrlkhelerlqkylsgfrllkrlpdaifvvdptkeaiavrearklfipvia
    ladtdsdpdlvdyiipgnddairsiqlilsravdliiqarggvvepspsyalvqe