PDB entry 2om6

View 2om6 on RCSB PDB site
Description: Hypothetical Protein (Probable Phosphoserine Phosph (PH0253) from Pyrococcus Horikoshii OT3
Class: hydrolase
Keywords: Rossmann fold, B-hairpin, four-helix bundle, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, HYDROLASE
Deposited on 2007-01-21, released 2008-01-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.186
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Probable phosphoserine phosphatase
    Species: Pyrococcus horikoshii [TaxId:70601]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2om6a_
  • Chain 'B':
    Compound: Probable phosphoserine phosphatase
    Species: Pyrococcus horikoshii [TaxId:70601]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2om6b_
  • Heterogens: SO4, MG, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2om6A (A:)
    mrevklvtfdvwntlldlnimldefshqlakisglhikdvanavievrneikkmraqase
    dprkvltgsqealagklkvdvelvkratarailnvdeslvlegtkealqfvkerglktav
    ignvmfwpgsytrlllerfglmefidktffadevlsykprkemfekvlnsfevkpeeslh
    igdtyaedyqgarkvgmwavwinqegdkvrkleergfeipsianlkdvieliskt
    

    Sequence, based on observed residues (ATOM records): (download)
    >2om6A (A:)
    mrevklvtfdvwntlldlnimldefshqlakisglhikdvanavievrneikkmraqase
    dprkvltgsqealagklkvdvelvkratarailnvdeslvlegtkealqfvkerglktav
    ignvmfwpgsytrlllerfglmefidktffadevlsykprkemfekvlnsfevkpeeslh
    igdtyaedyqgarkvgmwavwinqegdkvrkleergfeipsianlkdvielis
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2om6B (B:)
    mrevklvtfdvwntlldlnimldefshqlakisglhikdvanavievrneikkmraqase
    dprkvltgsqealagklkvdvelvkratarailnvdeslvlegtkealqfvkerglktav
    ignvmfwpgsytrlllerfglmefidktffadevlsykprkemfekvlnsfevkpeeslh
    igdtyaedyqgarkvgmwavwinqegdkvrkleergfeipsianlkdvieliskt
    

    Sequence, based on observed residues (ATOM records): (download)
    >2om6B (B:)
    mrevklvtfdvwntlldlnimldefshqlakisglhikdvanavievrneikkmraqase
    dprkvltgsqealagklkvdvelvkratarailnvdeslvlegtkealqfvkerglktav
    ignvmfwpgsytrlllerfglmefidktffadevlsykprkemfekvlnsfevkpeeslh
    igdtyaedyqgarkvgmwavwinqegdkvrkleergfeipsianlkdvielis