PDB entry 2om0

View 2om0 on RCSB PDB site
Description: Structure of human insulin in presence of urea at pH 6.5
Class: hormone
Keywords: R6 conformation, hormone
Deposited on 2007-01-20, released 2007-12-04
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-03-07, with a file datestamp of 2018-03-02.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

• Chain '1':
  Compound: insulin A chain
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01308 (0-20)
• Chain '2':
  Compound: insulin B chain
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01308 (0-End)
  Domains in SCOPe 2.08: d2om021
• Chain '3':
  Compound: insulin A chain
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01308 (0-20)
• Chain '4':
  Compound: insulin B chain
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01308 (0-End)
  Domains in SCOPe 2.08: d2om041
• Chain 'A':
  Compound: insulin A chain
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01308 (0-20)
• Chain 'B':
  Compound: insulin B chain
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01308 (0-End)
  Domains in SCOPe 2.08: d2om0b1
• Chain 'C':
  Compound: insulin A chain
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01308 (0-20)
• Chain 'D':
  Compound: insulin B chain
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01308 (0-End)
  Domains in SCOPe 2.08: d2om0d1
• Chain 'E':
  Compound: insulin A chain
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01308 (0-20)
• Chain 'F':
  Compound: insulin B chain
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01308 (0-End)
  Domains in SCOPe 2.08: d2om0f1
• Chain 'G':
  Compound: insulin A chain
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01308 (0-20)
• Chain 'H':
  Compound: insulin B chain
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01308 (0-End)
  Domains in SCOPe 2.08: d2om0h1
• Chain 'I':
  Compound: insulin A chain
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01308 (0-20)
• Chain 'J':
  Compound: insulin B chain
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01308 (0-End)
  Domains in SCOPe 2.08: d2om0j1
• Chain 'K':
  Compound: insulin A chain
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01308 (0-20)
• Chain 'L':
  Compound: insulin B chain
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01308 (0-End)
  Domains in SCOPe 2.08: d2om0l1
• Chain 'Q':
  Compound: insulin A chain
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01308 (0-20)
• Chain 'R':
  Compound: insulin B chain
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01308 (0-End)
  Domains in SCOPe 2.08: d2om0r1
• Chain 'S':
  Compound: insulin A chain
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01308 (0-20)
• Chain 'T':
  Compound: insulin B chain
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01308 (0-End)
  Domains in SCOPe 2.08: d2om0t1
• Chain 'U':
  Compound: insulin A chain
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01308 (0-20)
• Chain 'V':
  Compound: insulin B chain
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01308 (0-End)
  Domains in SCOPe 2.08: d2om0v1
• Chain 'X':
  Compound: insulin A chain
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01308 (0-20)
• Chain 'Y':
  Compound: insulin B chain
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01308 (0-End)
  Domains in SCOPe 2.08: d2om0y1
• Chain 'a':
  Compound: insulin A chain
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01308 (0-20)
• Chain 'b':
  Compound: insulin B chain
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01308 (0-End)
• Chain 'c':
  Compound: insulin A chain
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01308 (0-20)
• Chain 'd':
  Compound: insulin B chain
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01308 (0-End)
• Chain 'e':
  Compound: insulin A chain
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01308 (0-20)
• Chain 'f':
  Compound: insulin B chain
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01308 (0-End)
• Chain 'g':
  Compound: insulin A chain
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01308 (0-20)
• Chain 'h':
  Compound: insulin B chain
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01308 (0-End)
• Chain 'i':
  Compound: insulin A chain
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01308 (0-20)
• Chain 'j':
  Compound: insulin B chain
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01308 (0-End)
• Chain 'k':
  Compound: insulin A chain
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01308 (0-20)
• Chain 'l':
  Compound: insulin B chain
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01308 (0-End)
• Heterogens: RCO, URE, ZN, CL, HOH

PDB Chain Sequences:

• Chain '1':
  No sequence available.
  
  
• Chain '2':
  Sequence, based on SEQRES records: (download)
  

  >2om02 (2:)
  fvnqhlcgshlvealylvcgergffytpkt
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >2om02 (2:)
  fvnqhlcgshlvealylvcgergffytpk
  

  
  
• Chain '3':
  No sequence available.
  
  
• Chain '4':
  Sequence, based on SEQRES records: (download)
  

  >2om04 (4:)
  fvnqhlcgshlvealylvcgergffytpkt
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >2om04 (4:)
  fvnqhlcgshlvealylvcgergffytpk
  

  
  
• Chain 'A':
  No sequence available.
  
  
• Chain 'B':
  Sequence, based on SEQRES records: (download)
  

  >2om0B (B:)
  fvnqhlcgshlvealylvcgergffytpkt
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >2om0B (B:)
  fvnqhlcgshlvealylvcgergffytpk
  

  
  
• Chain 'C':
  No sequence available.
  
  
• Chain 'D':
  Sequence, based on SEQRES records: (download)
  

  >2om0D (D:)
  fvnqhlcgshlvealylvcgergffytpkt
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >2om0D (D:)
  fvnqhlcgshlvealylvcgergffytpk
  

  
  
• Chain 'E':
  No sequence available.
  
  
• Chain 'F':
  Sequence, based on SEQRES records: (download)
  

  >2om0F (F:)
  fvnqhlcgshlvealylvcgergffytpkt
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >2om0F (F:)
  fvnqhlcgshlvealylvcgergffytpk
  

  
  
• Chain 'G':
  No sequence available.
  
  
• Chain 'H':
  Sequence, based on SEQRES records: (download)
  

  >2om0H (H:)
  fvnqhlcgshlvealylvcgergffytpkt
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >2om0H (H:)
  fvnqhlcgshlvealylvcgergffytpk
  

  
  
• Chain 'I':
  No sequence available.
  
  
• Chain 'J':
  Sequence, based on SEQRES records: (download)
  

  >2om0J (J:)
  fvnqhlcgshlvealylvcgergffytpkt
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >2om0J (J:)
  fvnqhlcgshlvealylvcgergffytpk
  

  
  
• Chain 'K':
  No sequence available.
  
  
• Chain 'L':
  Sequence, based on SEQRES records: (download)
  

  >2om0L (L:)
  fvnqhlcgshlvealylvcgergffytpkt
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >2om0L (L:)
  fvnqhlcgshlvealylvcgergffytpk
  

  
  
• Chain 'Q':
  No sequence available.
  
  
• Chain 'R':
  Sequence, based on SEQRES records: (download)
  

  >2om0R (R:)
  fvnqhlcgshlvealylvcgergffytpkt
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >2om0R (R:)
  fvnqhlcgshlvealylvcgergffytpk
  

  
  
• Chain 'S':
  No sequence available.
  
  
• Chain 'T':
  Sequence, based on SEQRES records: (download)
  

  >2om0T (T:)
  fvnqhlcgshlvealylvcgergffytpkt
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >2om0T (T:)
  fvnqhlcgshlvealylvcgergffytpk
  

  
  
• Chain 'U':
  No sequence available.
  
  
• Chain 'V':
  Sequence, based on SEQRES records: (download)
  

  >2om0V (V:)
  fvnqhlcgshlvealylvcgergffytpkt
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >2om0V (V:)
  fvnqhlcgshlvealylvcgergffytpk
  

  
  
• Chain 'X':
  No sequence available.
  
  
• Chain 'Y':
  Sequence, based on SEQRES records: (download)
  

  >2om0Y (Y:)
  fvnqhlcgshlvealylvcgergffytpkt
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >2om0Y (Y:)
  fvnqhlcgshlvealylvcgergffytpk
  

  
  
• Chain 'a':
  No sequence available.
  
  
• Chain 'b':
  No sequence available.
  
  
• Chain 'c':
  No sequence available.
  
  
• Chain 'd':
  No sequence available.
  
  
• Chain 'e':
  No sequence available.
  
  
• Chain 'f':
  No sequence available.
  
  
• Chain 'g':
  No sequence available.
  
  
• Chain 'h':
  No sequence available.
  
  
• Chain 'i':
  No sequence available.
  
  
• Chain 'j':
  No sequence available.
  
  
• Chain 'k':
  No sequence available.
  
  
• Chain 'l':
  No sequence available.