PDB entry 2olz

View 2olz on RCSB PDB site
Description: Structure of human insulin in presence of thiocyanate at pH 7.0
Class: hormone
Keywords: R6 conformation, hormone
Deposited on 2007-01-20, released 2007-12-04
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-03-07, with a file datestamp of 2018-03-02.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: insulin a
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01308 (0-20)
• Chain 'B':
  Compound: insulin b
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01308 (0-End)
  Domains in SCOPe 2.08: d2olzb1
• Chain 'C':
  Compound: insulin a
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01308 (0-20)
• Chain 'D':
  Compound: insulin b
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01308 (0-End)
  Domains in SCOPe 2.08: d2olzd1
• Chain 'E':
  Compound: insulin a
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01308 (0-20)
• Chain 'F':
  Compound: insulin b
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01308 (0-End)
  Domains in SCOPe 2.08: d2olzf1
• Chain 'G':
  Compound: insulin a
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01308 (0-20)
• Chain 'H':
  Compound: insulin b
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01308 (0-End)
  Domains in SCOPe 2.08: d2olzh1
• Chain 'I':
  Compound: insulin a
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01308 (0-20)
• Chain 'J':
  Compound: insulin b
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01308 (0-End)
  Domains in SCOPe 2.08: d2olzj1
• Chain 'K':
  Compound: insulin a
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01308 (0-20)
• Chain 'L':
  Compound: insulin b
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01308 (0-End)
  Domains in SCOPe 2.08: d2olzl1
• Heterogens: RCO, ZN, SCN, GOL, HOH

PDB Chain Sequences:

• Chain 'A':
  No sequence available.
  
  
• Chain 'B':
  Sequence, based on SEQRES records: (download)
  

  >2olzB (B:)
  fvnqhlcgshlvealylvcgergffytpkt
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >2olzB (B:)
  fvnqhlcgshlvealylvcgergffytpk
  

  
  
• Chain 'C':
  No sequence available.
  
  
• Chain 'D':
  Sequence, based on SEQRES records: (download)
  

  >2olzD (D:)
  fvnqhlcgshlvealylvcgergffytpkt
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >2olzD (D:)
  fvnqhlcgshlvealylvcgergffytpk
  

  
  
• Chain 'E':
  No sequence available.
  
  
• Chain 'F':
  Sequence, based on SEQRES records: (download)
  

  >2olzF (F:)
  fvnqhlcgshlvealylvcgergffytpkt
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >2olzF (F:)
  fvnqhlcgshlvealylvcgergffytp
  

  
  
• Chain 'G':
  No sequence available.
  
  
• Chain 'H':
  Sequence, based on SEQRES records: (download)
  

  >2olzH (H:)
  fvnqhlcgshlvealylvcgergffytpkt
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >2olzH (H:)
  fvnqhlcgshlvealylvcgergffytpk
  

  
  
• Chain 'I':
  No sequence available.
  
  
• Chain 'J':
  Sequence, based on SEQRES records: (download)
  

  >2olzJ (J:)
  fvnqhlcgshlvealylvcgergffytpkt
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >2olzJ (J:)
  fvnqhlcgshlvealylvcgergffytpk
  

  
  
• Chain 'K':
  No sequence available.
  
  
• Chain 'L':
  Sequence, based on SEQRES records: (download)
  

  >2olzL (L:)
  fvnqhlcgshlvealylvcgergffytpkt
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >2olzL (L:)
  fvnqhlcgshlvealylvcgergffytp