PDB entry 2oly

View 2oly on RCSB PDB site
Description: Structure of human insulin in presence of urea at pH 7.0
Class: hormone
Keywords: R6 conformation, hormone
Deposited on 2007-01-20, released 2007-12-04
The last revision prior to the SCOP 1.75 freeze date was dated 2008-01-01, with a file datestamp of 2007-12-28.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.186
AEROSPACI score: 0.67 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: insulin A chain
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: insulin B chain
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2olyb1
  • Chain 'C':
    Compound: insulin A chain
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: insulin B chain
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2olyd1
  • Chain 'E':
    Compound: insulin A chain
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: insulin B chain
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2olyf1
  • Chain 'G':
    Compound: insulin A chain
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: insulin B chain
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2olyh1
  • Chain 'I':
    Compound: insulin A chain
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
  • Chain 'J':
    Compound: insulin B chain
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2olyj1
  • Chain 'K':
    Compound: insulin A chain
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
  • Chain 'L':
    Compound: insulin B chain
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2olyl1
  • Heterogens: ZN, CL, RCO, URE, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2olyB (B:)
    fvnqhlcgshlvealylvcgergffytpkt
    

    Sequence, based on observed residues (ATOM records): (download)
    >2olyB (B:)
    fvnqhlcgshlvealylvcgergffytp
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2olyD (D:)
    fvnqhlcgshlvealylvcgergffytpkt
    

    Sequence, based on observed residues (ATOM records): (download)
    >2olyD (D:)
    fvnqhlcgshlvealylvcgergffytp
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2olyF (F:)
    fvnqhlcgshlvealylvcgergffytpkt
    

    Sequence, based on observed residues (ATOM records): (download)
    >2olyF (F:)
    fvnqhlcgshlvealylvcgergffytpk
    

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2olyH (H:)
    fvnqhlcgshlvealylvcgergffytpkt
    

    Sequence, based on observed residues (ATOM records): (download)
    >2olyH (H:)
    fvnqhlcgshlvealylvcgergffytpk
    

  • Chain 'I':
    No sequence available.

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >2olyJ (J:)
    fvnqhlcgshlvealylvcgergffytpkt
    

    Sequence, based on observed residues (ATOM records): (download)
    >2olyJ (J:)
    fvnqhlcgshlvealylvcgergffytp
    

  • Chain 'K':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >2olyL (L:)
    fvnqhlcgshlvealylvcgergffytpkt
    

    Sequence, based on observed residues (ATOM records): (download)
    >2olyL (L:)
    fvnqhlcgshlvealylvcgergffytp