PDB entry 2oly
View 2oly on RCSB PDB site
Description: Structure of human insulin in presence of urea at pH 7.0
Class: hormone
Keywords: R6 conformation, hormone
Deposited on
2007-01-20, released
2007-12-04
The last revision prior to the SCOPe 2.08 freeze date was dated
2018-03-07, with a file datestamp of
2018-03-02.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.41
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: insulin A chain
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
- Chain 'B':
Compound: insulin B chain
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d2olyb1 - Chain 'C':
Compound: insulin A chain
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
- Chain 'D':
Compound: insulin B chain
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d2olyd1 - Chain 'E':
Compound: insulin A chain
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
- Chain 'F':
Compound: insulin B chain
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d2olyf1 - Chain 'G':
Compound: insulin A chain
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
- Chain 'H':
Compound: insulin B chain
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d2olyh1 - Chain 'I':
Compound: insulin A chain
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
- Chain 'J':
Compound: insulin B chain
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d2olyj1 - Chain 'K':
Compound: insulin A chain
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
- Chain 'L':
Compound: insulin B chain
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d2olyl1 - Heterogens: RCO, URE, ZN, CL, GOL, HOH
PDB Chain Sequences:
- Chain 'A':
No sequence available.
- Chain 'B':
Sequence, based on SEQRES records: (download)
>2olyB (B:)
fvnqhlcgshlvealylvcgergffytpkt
Sequence, based on observed residues (ATOM records): (download)
>2olyB (B:)
fvnqhlcgshlvealylvcgergffytp
- Chain 'C':
No sequence available.
- Chain 'D':
Sequence, based on SEQRES records: (download)
>2olyD (D:)
fvnqhlcgshlvealylvcgergffytpkt
Sequence, based on observed residues (ATOM records): (download)
>2olyD (D:)
fvnqhlcgshlvealylvcgergffytp
- Chain 'E':
No sequence available.
- Chain 'F':
Sequence, based on SEQRES records: (download)
>2olyF (F:)
fvnqhlcgshlvealylvcgergffytpkt
Sequence, based on observed residues (ATOM records): (download)
>2olyF (F:)
fvnqhlcgshlvealylvcgergffytpk
- Chain 'G':
No sequence available.
- Chain 'H':
Sequence, based on SEQRES records: (download)
>2olyH (H:)
fvnqhlcgshlvealylvcgergffytpkt
Sequence, based on observed residues (ATOM records): (download)
>2olyH (H:)
fvnqhlcgshlvealylvcgergffytpk
- Chain 'I':
No sequence available.
- Chain 'J':
Sequence, based on SEQRES records: (download)
>2olyJ (J:)
fvnqhlcgshlvealylvcgergffytpkt
Sequence, based on observed residues (ATOM records): (download)
>2olyJ (J:)
fvnqhlcgshlvealylvcgergffytp
- Chain 'K':
No sequence available.
- Chain 'L':
Sequence, based on SEQRES records: (download)
>2olyL (L:)
fvnqhlcgshlvealylvcgergffytpkt
Sequence, based on observed residues (ATOM records): (download)
>2olyL (L:)
fvnqhlcgshlvealylvcgergffytp