PDB entry 2olv

View 2olv on RCSB PDB site
Description: Structural Insight Into the Transglycosylation Step Of Bacterial Cell Wall Biosynthesis : Donor Ligand Complex
Class: transferase
Keywords: transpeptidase fold, glycosyltransferase family 51, lysozyme fold, TRANSFERASE
Deposited on 2007-01-19, released 2007-03-13
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.234
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Penicillin-binding protein 2
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: pbp2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q2YY56
      • modified residue (47)
      • modified residue (198)
      • variant (226)
      • modified residue (252)
      • modified residue (276)
      • modified residue (354)
      • variant (380)
      • modified residue (489)
      • modified residue (496)
      • modified residue (500)
      • modified residue (521)
      • modified residue (559)
      • modified residue (563)
      • modified residue (593)
    Domains in SCOPe 2.05: d2olva1, d2olva2
  • Chain 'B':
    Compound: Penicillin-binding protein 2
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: pbp2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q2YY56
      • modified residue (47)
      • modified residue (198)
      • variant (226)
      • modified residue (252)
      • modified residue (276)
      • modified residue (354)
      • variant (380)
      • modified residue (489)
      • modified residue (496)
      • modified residue (500)
      • modified residue (521)
      • modified residue (559)
      • modified residue (563)
      • modified residue (593)
    Domains in SCOPe 2.05: d2olvb1, d2olvb2
  • Heterogens: M0E

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2olvA (A:)
    mkapafteaklqdpipakiydkngelvktldngqrhehvnlkdvpksmkdavlatednrf
    yehgaldykrlfgaigknltggfgsegastltqqvvkdaflsqhksigrkaqeaylsyrl
    eqeyskddifqvylnkiyysdgvtgikaaakyyfnkdlkdlnlaeeaylaglpqvpnnyn
    iydhpkaaedrkntvlylmhyhkritdkqwedakkidlkanlvnrtpeerqnidtnqdse
    ynsyvnfvkselmnnkafkdenlgnvlqsgikiytnmdkdvqktlqndvdngsfyknkdq
    qvgatildsktgglvaisggrdfkdvvnrnqatdphptgsslkpflaygpaienmkwatn
    haiqdessyqvdgstfrnydtkshgtvsiydalrqsfnipalkawqsvkqnagndapkkf
    aaklglnyegdigpsevlggsasefsptqlasafaaianggtynnahsiqkvvtrdgeti
    eydhtshkamsdytaymlaemlkgtfkpygsayghgvsgvnmgaktgtgtygaetysqyn
    lpdnaakdvwingftpqytmsvwmgfskvkqygensfvghsqqeypqflyenvmskissr
    dgedfkrpssvsgsipsinvsgsqdnnttnrsthggsdtsanssgtaqsnnntrsqqsrn
    sggltgifn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2olvA (A:)
    aklqdpipakiydkngelvktldngqrhehvnlkdvpksmkdavlatednrfyehgaldy
    krlfgaigkgastltqqvvkdaflsqhksigrkaqeaylsyrleqeyskddifqvylnki
    yysdgvtgikaaakyyfnkdlkdlnlaeeaylaglpqvpnnyniydhpkaaedrkntvly
    lmhyhkritdkqwedakkidlkanlvnrtpeerqnidtnqdseynsyvnfvkselmnnka
    fkdenlgnvlqsgikiytnmdkdvqktlqndvdngsfyknkdqqvgatildsktgglvai
    sggrdfkdvvnrnqatdphptgsslkpflaygpaienmkwatnhaiqdessyqvdgstfr
    nydtkshgtvsiydalrqsfnipalkawqsvkqnagndapkkfaaklglnyegdigpsev
    lggsasefsptqlasafaaianggtynnahsiqkvvtrdgetieydhtshkamsdytaym
    laemlkgtfkpygsayghgvsgvnmgaktgtgtygaetysqynlpdnaakdvwingftpq
    ytmsvwmgfskvkqygensfvghsqqeypqflyenvmskissrdgedfkrpssvsgsips
    invsgsqdnnttnrsth
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2olvB (B:)
    mkapafteaklqdpipakiydkngelvktldngqrhehvnlkdvpksmkdavlatednrf
    yehgaldykrlfgaigknltggfgsegastltqqvvkdaflsqhksigrkaqeaylsyrl
    eqeyskddifqvylnkiyysdgvtgikaaakyyfnkdlkdlnlaeeaylaglpqvpnnyn
    iydhpkaaedrkntvlylmhyhkritdkqwedakkidlkanlvnrtpeerqnidtnqdse
    ynsyvnfvkselmnnkafkdenlgnvlqsgikiytnmdkdvqktlqndvdngsfyknkdq
    qvgatildsktgglvaisggrdfkdvvnrnqatdphptgsslkpflaygpaienmkwatn
    haiqdessyqvdgstfrnydtkshgtvsiydalrqsfnipalkawqsvkqnagndapkkf
    aaklglnyegdigpsevlggsasefsptqlasafaaianggtynnahsiqkvvtrdgeti
    eydhtshkamsdytaymlaemlkgtfkpygsayghgvsgvnmgaktgtgtygaetysqyn
    lpdnaakdvwingftpqytmsvwmgfskvkqygensfvghsqqeypqflyenvmskissr
    dgedfkrpssvsgsipsinvsgsqdnnttnrsthggsdtsanssgtaqsnnntrsqqsrn
    sggltgifn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2olvB (B:)
    aklqdpipakiydkngelvktldngqrhehvnlkdvpksmkdavlatednrfyehgaldy
    krlfgaigkngastltqqvvkdaflsqhksigrkaqeaylsyrleqeyskddifqvylnk
    iyysdgvtgikaaakyyfnkdlkdlnlaeeaylaglpqvpnnyniydhpkaaedrkntvl
    ylmhyhkritdkqwedakkidlkanlvnrtpeerqnidtnqdseynsyvnfvkselmnnk
    afkdenlgnvlqsgikiytnmdkdvqktlqndvdngsfyknkdqqvgatildsktgglva
    isggrdfkdvvnrnqatdphptgsslkpflaygpaienmkwatnhaiqdessyqvdgstf
    rnydtkshgtvsiydalrqsfnipalkawqsvkqnagndapkkfaaklglnyegdigpse
    vlggsasefsptqlasafaaianggtynnahsiqkvvtrdgetieydhtshkamsdytay
    mlaemlkgtfkpygsayghgvsgvnmgaktgtgtygaetysqynlpdnaakdvwingftp
    qytmsvwmgfskvkqygensfvghsqqeypqflyenvmskissrdgedfkrpssvsgsip
    sinvsgsqdnnttnrsth