PDB entry 2ol4

View 2ol4 on RCSB PDB site
Description: Crystal structure of plasmodium falciparum enoyl ACP reductase with triclosan reductase
Class: Oxidoreductase
Keywords: PfENR, malaria, triclosan analog, Oxidoreductase
Deposited on 2007-01-18, released 2007-07-17
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.26 Å
R-factor: 0.192
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: enoyl-acyl carrier reductase
    Species: Plasmodium falciparum [TaxId:5833]
    Gene: FabI
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2ol4a_
  • Chain 'B':
    Compound: enoyl-acyl carrier reductase
    Species: Plasmodium falciparum [TaxId:5833]
    Gene: FabI
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2ol4b_
  • Heterogens: NAD, JPN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ol4A (A:)
    mvhhhhhhnedicfiagigdtngygwgiakelskrnvkiifgiwppvynifmknykngkf
    dndmiidkdkkmnildmlpfdasfdtandideetknnkrynmlqnytiedvanlihqkyg
    kinmlvhslanakevqkdllntsrkgyldalskssyslislckyfvnimkpqssiislty
    hasqkvvpgygggmssakaalesdtrvlayhlgrnynirintisagplksraatainkln
    ntyenntnqnknrnshdvhnimnnsgekeekknsasqnytfidyaieysekyaplrqkll
    stdigsvasfllsresraitgqtiyvdnglnimflpdd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ol4A (A:)
    edicfiagigdtngygwgiakelskrnvkiifgiwppvynifmknykngkfdndmiidkk
    mnildmlpfdasfdtandideetknnkrynmlqnytiedvanlihqkygkinmlvhslan
    akevqkdllntsrkgyldalskssyslislckyfvnimkpqssiisltyhasqkvvpgyg
    ggmssakaalesdtrvlayhlgrnynirintisagplkstfidyaieysekyaplrqkll
    stdigsvasfllsresraitgqtiyvdnglnimflpd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2ol4B (B:)
    mvhhhhhhnedicfiagigdtngygwgiakelskrnvkiifgiwppvynifmknykngkf
    dndmiidkdkkmnildmlpfdasfdtandideetknnkrynmlqnytiedvanlihqkyg
    kinmlvhslanakevqkdllntsrkgyldalskssyslislckyfvnimkpqssiislty
    hasqkvvpgygggmssakaalesdtrvlayhlgrnynirintisagplksraatainkln
    ntyenntnqnknrnshdvhnimnnsgekeekknsasqnytfidyaieysekyaplrqkll
    stdigsvasfllsresraitgqtiyvdnglnimflpdd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ol4B (B:)
    dicfiagigdtngygwgiakelskrnvkiifgiwppvynifmknykngkfdndmikmnil
    dmlpfdasfdtandideetknnkrynmlqnytiedvanlihqkygkinmlvhslanakev
    qkdllntsrkgyldalskssyslislckyfvnimkpqssiisltyhasqkvvpgygggms
    sakaalesdtrvlayhlgrnynirintisagplksraataintfidyaieysekyaplrq
    kllstdigsvasfllsresraitgqtiyvdnglnimflpd