PDB entry 2oki

View 2oki on RCSB PDB site
Description: Crystal structure of dimeric form of PfFabZ in crystal form2
Class: lyase
Keywords: fabz, hotdog fold, non-isomorphism, plasmodium, LYASE
Deposited on 2007-01-17, released 2007-04-10
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.258
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-hydroxyacyl-ACP dehydratase
    Species: Plasmodium falciparum [TaxId:5833]
    Gene: FabZ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2okia_
  • Chain 'B':
    Compound: Beta-hydroxyacyl-ACP dehydratase
    Species: Plasmodium falciparum [TaxId:5833]
    Gene: FabZ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2okib_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2okiA (A:)
    kilphrypfllvdkviymqpnktiiglkqvstnepffnghfpqkqimpgvlqiealaqla
    gilclksddsqknnlflfagvdgvrwkkpvlpgdtltmqanlisfksslgiaklsgvgyv
    ngkvvinisemtfals
    

    Sequence, based on observed residues (ATOM records): (download)
    >2okiA (A:)
    kilphrypfllvdkviymqpnktiiglkqvstnepffnghfpqkqimpgvlqiealaqla
    gilclksnlflfagvdgvrwkkpvlpgdtltmqanlisfksaklsgvgyvngkvvinise
    mtfals
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2okiB (B:)
    kilphrypfllvdkviymqpnktiiglkqvstnepffnghfpqkqimpgvlqiealaqla
    gilclksddsqknnlflfagvdgvrwkkpvlpgdtltmqanlisfksslgiaklsgvgyv
    ngkvvinisemtfals
    

    Sequence, based on observed residues (ATOM records): (download)
    >2okiB (B:)
    lphrypfllvdkvipnktiiglkqvstnepffngqimpgvlqiealaqlagilclksnlf
    lfagvdgvrwkkpvlpgdtltmqanlisfksslgiaklsgvgyvngkvvinisemtfa