PDB entry 2okh

View 2okh on RCSB PDB site
Description: Crystal structure of dimeric form of PfFabZ in crystal form3
Class: lyase
Keywords: fabz, hotdog fold, non-isomorphism, plasmodium, LYASE
Deposited on 2007-01-16, released 2007-04-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.243
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-hydroxyacyl-ACP dehydratase
    Species: Plasmodium falciparum [TaxId:5833]
    Gene: FabZ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2okha_
  • Chain 'B':
    Compound: Beta-hydroxyacyl-ACP dehydratase
    Species: Plasmodium falciparum [TaxId:5833]
    Gene: FabZ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2okhb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2okhA (A:)
    kilphrypfllvdkviymqpnktiiglkqvstnepffnghfpqkqimpgvlqiealaqla
    gilclksddsqknnlflfagvdgvrwkkpvlpgdtltmqanlisfksslgiaklsgvgyv
    ngkvvinisemtfals
    

    Sequence, based on observed residues (ATOM records): (download)
    >2okhA (A:)
    kilphrypfllvdkviymqpnktiiglkqvstnepffqimpgvlqiealaqlagilcllf
    lfagvdgvrwkkpvlpgdtltmqanlisfksslgiaklsgvgyvngkvvinisemtfals
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2okhB (B:)
    kilphrypfllvdkviymqpnktiiglkqvstnepffnghfpqkqimpgvlqiealaqla
    gilclksddsqknnlflfagvdgvrwkkpvlpgdtltmqanlisfksslgiaklsgvgyv
    ngkvvinisemtfals
    

    Sequence, based on observed residues (ATOM records): (download)
    >2okhB (B:)
    kilphrypfllvdkviymqpnktiiglkqvstnepffqimpgvlqiealaqlagilclks
    dnlflfagvdgvrwkkpvlpgdtltmqanlisfksslgiaklsgvgyvngkvvinisemt
    fals