PDB entry 2oke

View 2oke on RCSB PDB site
Description: High Resolution Crystal Structures of Vaccinia Virus dUTPase
Class: hydrolase
Keywords: Fold, jelly-roll, Superfamily, dUTPase-like, forms tight trimer through an additional beta-sheet in each subunit, subunit beta-sheets are orthogonally packed around the three-fold axis, HYDROLASE
Deposited on 2007-01-16, released 2007-05-01
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.222
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: deoxyuridine 5'-triphosphate nucleotidohydrolase
    Species: Vaccinia virus [TaxId:10245]
    Gene: dut
    Database cross-references and differences (RAF-indexed):
    • GB AAO89320
      • engineered (27)
    Domains in SCOPe 2.06: d2okea_
  • Chain 'B':
    Compound: deoxyuridine 5'-triphosphate nucleotidohydrolase
    Species: Vaccinia virus [TaxId:10245]
    Gene: dut
    Database cross-references and differences (RAF-indexed):
    • GB AAO89320
      • engineered (27)
    Domains in SCOPe 2.06: d2okeb_
  • Chain 'C':
    Compound: deoxyuridine 5'-triphosphate nucleotidohydrolase
    Species: Vaccinia virus [TaxId:10245]
    Gene: dut
    Database cross-references and differences (RAF-indexed):
    • GB AAO89320
      • engineered (27)
    Domains in SCOPe 2.06: d2okec_
  • Heterogens: MG, CL, DUP, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2okeA (A:)
    mfnmninspvrfvketnraksptrqspgaagydlysaydytippgerqliktdismsmpk
    fcygriaprsglslkgidigggvidedyrgnigvilinngkctfnvntgdriaqliyqri
    yypeleevqsldstnrgdqgfgstglr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2okeA (A:)
    pvrfvketnraksptrqspgaagydlysaydytippgerqliktdismsmpkfcygriap
    rsglslkgidigggvidedyrgnigvilinngkctfnvntgdriaqliyqriyypeleev
    qsl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2okeB (B:)
    mfnmninspvrfvketnraksptrqspgaagydlysaydytippgerqliktdismsmpk
    fcygriaprsglslkgidigggvidedyrgnigvilinngkctfnvntgdriaqliyqri
    yypeleevqsldstnrgdqgfgstglr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2okeB (B:)
    pvrfvketnraksptrqspgaagydlysaydytippgerqliktdismsmpkfcygriap
    rsglslkgidigggvidedyrgnigvilinngkctfnvntgdriaqliyqriyypeleev
    qsl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2okeC (C:)
    mfnmninspvrfvketnraksptrqspgaagydlysaydytippgerqliktdismsmpk
    fcygriaprsglslkgidigggvidedyrgnigvilinngkctfnvntgdriaqliyqri
    yypeleevqsldstnrgdqgfgstglr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2okeC (C:)
    pvrfvketnraksptrqspgaagydlysaydytippgerqliktdismsmpkfcygriap
    rsglslkgidigggvidedyrgnigvilinngkctfnvntgdriaqliyqriyypeleev
    qsl