PDB entry 2okc

View 2okc on RCSB PDB site
Description: Crystal structure of Type I restriction enzyme StySJI M protein (NP_813429.1) from Bacteroides thetaiotaomicron VPI-5482 at 2.20 A resolution
Class: transferase
Keywords: NP_813429.1, N-6 DNA Methylase, Type I restriction enzyme StySJI M protein, Structural Genomics, Joint Center for Structural Genomics, JCSG, Protein Structure Initiative, PSI-2, TRANSFERASE
Deposited on 2007-01-16, released 2007-01-30
The last revision prior to the SCOPe 2.02 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.185
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Type I restriction enzyme StySJI M protein
    Species: Bacteroides thetaiotaomicron [TaxId:226186]
    Gene: NP_813429.1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q89Z59
      • modified residue (44)
      • modified residue (51)
      • modified residue (116)
      • modified residue (125)
      • modified residue (162)
      • modified residue (170)
      • modified residue (192)
      • modified residue (225)
      • modified residue (292-293)
      • modified residue (295)
    Domains in SCOPe 2.02: d2okca1
  • Chain 'B':
    Compound: Type I restriction enzyme StySJI M protein
    Species: Bacteroides thetaiotaomicron [TaxId:226186]
    Gene: NP_813429.1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q89Z59
      • modified residue (44)
      • modified residue (51)
      • modified residue (116)
      • modified residue (125)
      • modified residue (162)
      • modified residue (170)
      • modified residue (192)
      • modified residue (225)
      • modified residue (292-293)
      • modified residue (295)
    Domains in SCOPe 2.02: d2okcb_
  • Heterogens: CL, SAM, GOL, IPA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2okcA (A:)
    gmatnssteqsltkkvwnlattlagqgigftdyitqltyllflkmdaenvemfgeesaip
    tgyqwadliafdgldlvkqyeetlkllseldnligtiytkaqnkidkpvylkkvitmide
    eqwlimdgdvkgaiyesilekngqdkksgagqyftprpliqamvdcinpqmgetvcdpac
    gtggflltaydymkgqsaskekrdflrdkalhgvdntplvvtlasmnlylhgigtdrspi
    vcedslekepstlvdvilanppfgtrpagsvdinrpdfyvetknnqlnflqhmmlmlktg
    graavvlpdnvlfeagagetirkrllqdfnlhtilrlptgifyaqgvkanvlffskgqpt
    keiwfydyrtdikhtlatnklerhhlddfvscynnrveiydaennpqgrwrkypvdeiia
    rdktslditwikpggevddrslael
    

    Sequence, based on observed residues (ATOM records): (download)
    >2okcA (A:)
    qsltkkvwnlattlagqgigftdyitqltyllflkmdaenvemfgeesaiptgyqwadli
    afdgldlvkqyeetlkllseldnligtiytkaqnkidkpvylkkvitmideeqwlimdgd
    vkgaiyesilekngqdkksgagqyftprpliqamvdcinpqmgetvcdpacgtggfllta
    ydymkgqsskekrdflrdkalhgvdntplvvtlasmnlylhgigtdrspivcedslekep
    stlvdvilanppfgtrpagsvdinrpdfyvetknnqlnflqhmmlmlktggraavvlpdn
    vlfeagagetirkrllqdfnlhtilrlptgifyaqgvkanvlffskgqptkeiwfydyrt
    dikhtlatnklerhhlddfvscynnrveiydaennpqgrwrkypvdeiiardktslditw
    ikpg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2okcB (B:)
    gmatnssteqsltkkvwnlattlagqgigftdyitqltyllflkmdaenvemfgeesaip
    tgyqwadliafdgldlvkqyeetlkllseldnligtiytkaqnkidkpvylkkvitmide
    eqwlimdgdvkgaiyesilekngqdkksgagqyftprpliqamvdcinpqmgetvcdpac
    gtggflltaydymkgqsaskekrdflrdkalhgvdntplvvtlasmnlylhgigtdrspi
    vcedslekepstlvdvilanppfgtrpagsvdinrpdfyvetknnqlnflqhmmlmlktg
    graavvlpdnvlfeagagetirkrllqdfnlhtilrlptgifyaqgvkanvlffskgqpt
    keiwfydyrtdikhtlatnklerhhlddfvscynnrveiydaennpqgrwrkypvdeiia
    rdktslditwikpggevddrslael
    

    Sequence, based on observed residues (ATOM records): (download)
    >2okcB (B:)
    teqsltkkvwnlattlagqgigftdyitqltyllflkmdaenvemfgeesaiptgyqwad
    liafdgldlvkqyeetlkllseldnligtiytkaqnkidkpvylkkvitmideeqwlimd
    gdvkgaiyesilekngqdkksgagqyftprpliqamvdcinpqmgetvcdpacgtggfll
    taydymkgqsaskekrdflrdkalhgvdntplvvtlasmnlylhgigtdrspivcedsle
    kepstlvdvilanppfgtrpagsvdinrpdfyvetknnqlnflqhmmlmlktggraavvl
    pdnvlfeagagetirkrllqdfnlhtilrlptgifyaqgvkanvlffskgqptkeiwfyd
    yrtdikhtlatnklerhhlddfvscynnrveiydaennpqgrwrkypvdeiiardktsld
    itwikp