PDB entry 2okb

View 2okb on RCSB PDB site
Description: High Resolution Crystal Structures of Vaccinia Virus dUTPase
Class: hydrolase
Keywords: Fold, jelly-roll, Superfamily, dUTPase-like, forms tight trimer through an additional beta-sheet in each subunit, subunit beta-sheets are orthogonally packed around the three-fold axis, HYDROLASE
Deposited on 2007-01-16, released 2007-05-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.212
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: deoxyuridine 5'-triphosphate nucleotidohydrolase
    Species: Vaccinia virus [TaxId:10245]
    Gene: dut
    Database cross-references and differences (RAF-indexed):
    • GB AAO89320 (1-End)
      • initiating methionine (0)
      • engineered (17)
    Domains in SCOPe 2.07: d2okba_
  • Chain 'B':
    Compound: deoxyuridine 5'-triphosphate nucleotidohydrolase
    Species: Vaccinia virus [TaxId:10245]
    Gene: dut
    Database cross-references and differences (RAF-indexed):
    • GB AAO89320 (1-End)
      • initiating methionine (0)
      • engineered (17)
    Domains in SCOPe 2.07: d2okbb_
  • Chain 'C':
    Compound: deoxyuridine 5'-triphosphate nucleotidohydrolase
    Species: Vaccinia virus [TaxId:10245]
    Gene: dut
    Database cross-references and differences (RAF-indexed):
    • GB AAO89320 (1-End)
      • initiating methionine (0)
      • engineered (17)
    Domains in SCOPe 2.07: d2okbc_
  • Heterogens: SO4, CL, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2okbA (A:)
    mfvketnraksptrqspgaagydlysaydytippgerqliktdismsmpkfcygriaprs
    glslkgidigggvidedyrgnigvilinngkctfnvntgdriaqliyqriyypeleevqs
    ldstnrgdqgfgstglr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2okbA (A:)
    mfvketnraksptrqspgaagydlysaydytippgerqliktdismsmpkfcygriaprs
    glslkgidigggvidedyrgnigvilinngkctfnvntgdriaqliyqriyyp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2okbB (B:)
    mfvketnraksptrqspgaagydlysaydytippgerqliktdismsmpkfcygriaprs
    glslkgidigggvidedyrgnigvilinngkctfnvntgdriaqliyqriyypeleevqs
    ldstnrgdqgfgstglr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2okbB (B:)
    mfvketnraksptrqspgaagydlysaydytippgerqliktdismsmpkfcygriaprs
    glslkgidigggvidedyrgnigvilinngkctfnvntgdriaqliyqriyyp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2okbC (C:)
    mfvketnraksptrqspgaagydlysaydytippgerqliktdismsmpkfcygriaprs
    glslkgidigggvidedyrgnigvilinngkctfnvntgdriaqliyqriyypeleevqs
    ldstnrgdqgfgstglr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2okbC (C:)
    mfvketnraksptrqspgaagydlysaydytippgerqliktdismsmpkfcygriaprs
    glslkgidigggvidedyrgnigvilinngkctfnvntgdriaqliyqriyyp