PDB entry 2ok3

View 2ok3 on RCSB PDB site
Description: X-ray structure of human cyclophilin J at 2.0 angstrom
Class: isomerase
Keywords: beta-barrel, helix, disulfide bridge, ISOMERASE
Deposited on 2007-01-15, released 2008-01-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.202
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peptidyl-prolyl cis-trans isomerase-like 3
    Species: Homo sapiens [TaxId:9606]
    Gene: PPIL3b
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ok3a_
  • Heterogens: NI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ok3A (A:)
    msvtlhtdvgdikievfcertpktcenflalcasnyyngcifhrnikgfmvqtgdptgtg
    rggnsiwgkkfedeyseylkhnvrgvvsmanngpntngsqffitygkqphldmkytvfgk
    vidgletldeleklpvnektyrplndvhikditihanpfaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ok3A (A:)
    msvtlhtdvgdikievfcertpktcenflalcasnyyngcifhrnikgfmvqtgdptgtg
    rggnsiwgkkfedeyseylkhnvrgvvsmanngpntngsqffitygkqphldmkytvfgk
    vidgletldeleklpvnektyrplndvhikditihanpfa