PDB entry 2ok0

View 2ok0 on RCSB PDB site
Description: Fab ED10-DNA complex
Class: immune system/DNA
Keywords: immunoglobulin fold, IMMUNE SYSTEM-DNA COMPLEX
Deposited on 2007-01-15, released 2007-06-12
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.89 Å
R-factor: 0.178
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'D':
    Compound: 5'-d(*tp*c)-3'
  • Chain 'H':
    Compound: Fab ED10 heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 2OK0 (0-215)
    Domains in SCOPe 2.05: d2ok0h1
  • Chain 'L':
    Compound: Fab ED10 light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 2OK0 (0-218)
    Domains in SCOPe 2.05: d2ok0l1, d2ok0l2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'D':
    No sequence available.

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ok0H (H:)
    evqleesgpelvkpgasvkisckasgytftdyymnwlrqkpgqglewigwvypgsikyne
    kfkdkatltadtsssivymhlssltsddnavyfctrwtygssfdywgegtlltvssaktt
    ppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytl
    sssvtvpsstwpsetvtcnvahpasstkvdkkivpr
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ok0L (L:)
    dilmtqtplslpvslgdqasiscrssqsivhsngntylewylqkpgqsptlliykvsnrf
    sgvpdrfsgsgsgtdftlkisrveaedlgvyycfqgshipltfgagtklevkrsdaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrnec