PDB entry 2ojz

View 2ojz on RCSB PDB site
Description: Anti-DNA antibody ED10
Class: immune system
Keywords: immunoglobulin fold
Deposited on 2007-01-15, released 2007-06-12
The last revision prior to the SCOP 1.75 freeze date was dated 2007-06-26, with a file datestamp of 2007-06-22.
Experiment type: XRAY
Resolution: 2.73 Å
R-factor: 0.204
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: Fab ED10 heavy chain
    Species: MUS MUSCULUS
    Domains in SCOP 1.75: d2ojzh1
  • Chain 'I':
    Compound: Fab ED10 heavy chain
    Species: MUS MUSCULUS
    Domains in SCOP 1.75: d2ojzi1
  • Chain 'L':
    Compound: Fab ED10 light chain
    Species: MUS MUSCULUS
    Domains in SCOP 1.75: d2ojzl1, d2ojzl2
  • Chain 'M':
    Compound: Fab ED10 light chain
    Species: MUS MUSCULUS
    Domains in SCOP 1.75: d2ojzm1, d2ojzm2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ojzH (H:)
    evqleesgpelvkpgasvkisckasgytftdyymnwlrqkpgqglewigwvypgsikyne
    kfkdkatltadtsssivymhlssltsddnavyfctrwtygssfdywgegtlltvssaktt
    ppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytl
    sssvtvpsstwpsetvtcnvahpasstkvdkkivpr
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ojzI (I:)
    evqleesgpelvkpgasvkisckasgytftdyymnwlrqkpgqglewigwvypgsikyne
    kfkdkatltadtsssivymhlssltsddnavyfctrwtygssfdywgegtlltvssaktt
    ppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytl
    sssvtvpsstwpsetvtcnvahpasstkvdkkivpr
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >2ojzL (L:)
    dilmtqtplslpvslgdqasiscrssqsivhsngntylewylqkpgqsptlliykvsnrf
    sgvpdrfsgsgsgtdftlkisrveaedlgvyycfqgshipltfgagtklevkrsdaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ojzL (L:)
    dilmtqtplslpvslgdqasiscrssqsivhsngntylewylqkpgqsptlliykvsnrf
    sgvpdrfsgsgsgtdftlkisrveaedlgvyycfqgshipltfgagtklevkrsdaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrne
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >2ojzM (M:)
    dilmtqtplslpvslgdqasiscrssqsivhsngntylewylqkpgqsptlliykvsnrf
    sgvpdrfsgsgsgtdftlkisrveaedlgvyycfqgshipltfgagtklevkrsdaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ojzM (M:)
    dilmtqtplslpvslgdqasiscrssqsivhsngntylewylqkpgqsptlliykvsnrf
    sgvpdrfsgsgsgtdftlkisrveaedlgvyycfqgshipltfgagtklevkrsdaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrne