PDB entry 2ojl

View 2ojl on RCSB PDB site
Description: Crystal structure of Q7WAF1_BORPA from Bordetella parapertussis. Northeast Structural Genomics target BpR68.
Class: structural genomics, unknown function
Keywords: bpr68, nesg, Q7WAF1, Structural Genomics, PSI-2, Protein Structure Initiative, Northeast Structural Genomics Consortium, UNKNOWN FUNCTION
Deposited on 2007-01-12, released 2007-01-23
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein
    Species: Bordetella parapertussis [TaxId:257311]
    Gene: BPP1426
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7WAF1
      • modified residue (27)
    Domains in SCOPe 2.08: d2ojla_
  • Chain 'B':
    Compound: hypothetical protein
    Species: Bordetella parapertussis [TaxId:257311]
    Gene: BPP1426
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7WAF1
      • modified residue (27)
    Domains in SCOPe 2.08: d2ojlb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2ojlA (A:)
mitppdhppriaiqyctqcqwllraawmaqellstfgadlgevalvpgtggvfrihynga
plwdrevdggfpeakvlkqrvrdhldpgrplghidgrpkplehhhhhh

    Sequence, based on observed residues (ATOM records): (download) 
    >2ojlA (A:)
hppriaiqyctqcqwllraawmaqellstfgadlgevalvpgtggvfrihyngaplwdre
vdggfpeakvlkqrvrdhl

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >2ojlB (B:)
mitppdhppriaiqyctqcqwllraawmaqellstfgadlgevalvpgtggvfrihynga
plwdrevdggfpeakvlkqrvrdhldpgrplghidgrpkplehhhhhh

    Sequence, based on observed residues (ATOM records): (download) 
    >2ojlB (B:)
priaiqyctqcqwllraawmaqellstfgadlgevalvpgtggvfrihyngaplwdrevd
ggfpeakvlkqrvrdhl