PDB entry 2ojk

View 2ojk on RCSB PDB site
Description: Crystal Structure of Green Fluorescent Protein from Zoanthus sp at 2.2 A Resolution
Class: fluorescent protein
Keywords: green fluorescent protein, zoanthus sp, chromophore structure, FLUORESCENT PROTEIN
Deposited on 2007-01-12, released 2007-09-25
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.184
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: GFP-like fluorescent chromoprotein FP506
    Species: Zoanthus sp. [TaxId:105402]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9U6Y5 (Start-230)
      • chromophore (65)
    Domains in SCOPe 2.06: d2ojka_
  • Chain 'B':
    Compound: GFP-like fluorescent chromoprotein FP506
    Species: Zoanthus sp. [TaxId:105402]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9U6Y5 (Start-230)
      • chromophore (65)
    Domains in SCOPe 2.06: d2ojkb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ojkA (A:)
    maqskhgltkemtmkyrmegcvdghkfvitgegigypfkgkqainlcvveggplpfaedi
    lsaafnygnrvfteypqdivdyfknscpagytwdrsflfedgavcicnaditvsveencm
    yheskfygvnfpadgpvmkkmtdnwepscekiipvpkqgilkgdvsmylllkdggrlrcq
    fdtvykaksvprkmpdwhfiqhkltredrsdaknqkwhltehaiasgsalp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ojkA (A:)
    skhgltkemtmkyrmegcvdghkfvitgegigypfkgkqainlcvveggplpfaedilsa
    afnygnrvfteypqdivdyfknscpagytwdrsflfedgavcicnaditvsveencmyhe
    skfygvnfpadgpvmkkmtdnwepscekiipvpkqgilkgdvsmylllkdggrlrcqfdt
    vykaksvprkmpdwhfiqhkltredrsdaknqkwhltehaiasgsalp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2ojkB (B:)
    maqskhgltkemtmkyrmegcvdghkfvitgegigypfkgkqainlcvveggplpfaedi
    lsaafnygnrvfteypqdivdyfknscpagytwdrsflfedgavcicnaditvsveencm
    yheskfygvnfpadgpvmkkmtdnwepscekiipvpkqgilkgdvsmylllkdggrlrcq
    fdtvykaksvprkmpdwhfiqhkltredrsdaknqkwhltehaiasgsalp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ojkB (B:)
    skhgltkemtmkyrmegcvdghkfvitgegigypfkgkqainlcvveggplpfaedilsa
    afnygnrvfteypqdivdyfknscpagytwdrsflfedgavcicnaditvsveencmyhe
    skfygvnfpadgpvmkkmtdnwepscekiipvpkqgilkgdvsmylllkdggrlrcqfdt
    vykaksvprkmpdwhfiqhkltredrsdaknqkwhltehaiasgsalp