PDB entry 2oji

View 2oji on RCSB PDB site
Description: Crystal structure of ERK2 in complex with N-benzyl-4-(4-(3-chlorophenyl)-1H-pyrazol-3-yl)-1H-pyrrole-2-carboxamide
Class: transferase
Keywords: kinase inhibitor, TRANSFERASE
Deposited on 2007-01-12, released 2007-02-06
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.215
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mitogen-activated protein kinase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: MAPK1, ERK2, PRKM1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2ojia_
  • Heterogens: SO4, 33A, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ojiA (A:)
    mgsshhhhhhssglvprgshmaaaaaagagpemvrgqvfdvgprytnlsyigegaygmvc
    saydnvnkvrvaikkispfehqtycqrtlreikillrfrheniigindiiraptieqmkd
    vyivqdlmetdlykllktqhlsndhicyflyqilrglkyihsanvlhrdlkpsnlllntt
    cdlkicdfglarvadpdhdhtgflteyvatrwyrapeimlnskgytksidiwsvgcilae
    mlsnrpifpgkhyldqlnhilgilgspsqedlnciinlkarnyllslphknkvpwnrlfp
    nadskaldlldkmltfnphkrieveqalahpyleqyydpsdepiaeapfkfdmelddlpk
    eklkelifeetarfqpgyrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ojiA (A:)
    rgqvfdvgprytnlsyigegaygmvcsaydnvnkvrvaikkispfehqtycqrtlreiki
    llrfrheniigindiiraptieqmkdvyivqdlmetdlykllktqhlsndhicyflyqil
    rglkyihsanvlhrdlkpsnlllnttcdlkicdfglarvadpdhdhtgflteyvatrwyr
    apeimlnskgytksidiwsvgcilaemlsnrpifpgkhyldqlnhilgilgspsqedlnc
    iinlkarnyllslphknkvpwnrlfpnadskaldlldkmltfnphkrieveqalahpyle
    qyydpsdepiaeapfkfdmelddlpkeklkelifeetarfqpgy