PDB entry 2ojf

View 2ojf on RCSB PDB site
Description: Crystal structure of Protein Kinase A in complex with Pyridine-Pyrazolopyridine based inhibitors
Class: transferase
Keywords: Protein Kinase A, AKT, TRANSFERASE
Deposited on 2007-01-12, released 2007-03-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.265
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'E':
    Compound: cAMP-dependent protein kinase, alpha-catalytic subunit
    Species: Bos taurus [TaxId:9913]
    Gene: PRKACA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ojfe_
  • Chain 'I':
    Compound: Inhibitory peptide
    Database cross-references and differences (RAF-indexed):
    • PDB 2OJF (0-19)
  • Heterogens: 4PY

PDB Chain Sequences:

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2ojfE (E:)
    mgnaaaakkgseqesvkeflakakedflkkwenpaqntahldqferiktlgtgsfgrvml
    vkhmetgnhyamkildkqkvvklkqiehtlnekrilqavnfpflvklefsfkdnsnlymv
    meyvpggemfshlrrigrfsepharfyaaqivltfeylhsldliyrdlkpenllidqqgy
    iqvtdfgfakrvkgrtwtlcgtpeylapeiilskgynkavdwwalgvliyemaagyppff
    adqpiqiyekivsgkvrfpshfssdlkdllrnllqvdltkrfgnlkngvndiknhkwfat
    tdwiaiyqrkveapfipkfkgpgdtsnfddyeeeeirvsinekcgkefsef
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ojfE (E:)
    vkeflakakedflkkwenpaqntahldqferiktlgtgsfgrvmlvkhmetgnhyamkil
    dkqkvvklkqiehtlnekrilqavnfpflvklefsfkdnsnlymvmeyvpggemfshlrr
    igrfsepharfyaaqivltfeylhsldliyrdlkpenllidqqgyiqvtdfgfakrvkgr
    twtlcgtpeylapeiilskgynkavdwwalgvliyemaagyppffadqpiqiyekivsgk
    vrfpshfssdlkdllrnllqvdltkrfgnlkngvndiknhkwfattdwiaiyqrkveapf
    ipkfkgpgdtsnfddyeeeeirvsinekcgkefsef
    

  • Chain 'I':
    No sequence available.