PDB entry 2ojd

View 2ojd on RCSB PDB site
Description: Structural Analysis of CYP2R1 in complex with vitamin D3
Class: oxidoreductase
Keywords: cytochrome p450, vitamin d, vitamin s 25-hydroxylase, drug metabolism, Structural Genomics, Structural Genomics Consortium, SGC
Deposited on 2007-01-12, released 2007-01-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2008-02-19, with a file datestamp of 2008-02-15.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.218
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytochrome P450 2R1
    Species: HOMO SAPIENS
    Gene: CYP2R1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6VVX0 (Start-474)
      • his tag (475)
    Domains in SCOPe 2.07: d2ojda1, d2ojda2
  • Chain 'B':
    Compound: Cytochrome P450 2R1
    Species: HOMO SAPIENS
    Gene: CYP2R1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6VVX0 (Start-474)
      • his tag (475-478)
    Domains in SCOPe 2.07: d2ojdb1, d2ojdb2
  • Heterogens: BCD, HEM, VD3, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ojdA (A:)
    makktkqrrpmgfppgppglpfigniyslaasselphvymrkqsqvygeifsldlggist
    vvlngydvvkeclvhqseifadrpclplfmkmtkmggllnsrygrgwvdhrrlavnsfry
    fgygqksfeskileetkffndaietykgrpfdfkqlitnavsnitnliifgerftyedtd
    fqhmielfsenvelaasasvflynafpwigilpfgkhqqlfrnaavvydflsrliekasv
    nrkpqlpqhfvdayldemdqgkndpsstfskenlifsvgeliiagtetttnvlrwailfm
    alypniqgqvqkeidlimgpngkpswddkckmpyteavlhevlrfcnivplgifhatsed
    avvrgysipkgttvitnlysvhfdekywrdpevfhperfldssgyfakkealvpfslgrr
    hclgehlarmemflfftallqrfhlhfphelvpdlkprlgmtlqpqpylicaerrhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ojdA (A:)
    fppgppglpfigniyslaasselphvymrkqsqvygeifsldlggistvvlngydvvkec
    lvhqseifadrpclplfmkmtkmggllnsrygrgwvdhrrlavnsfryfgygqksfeski
    leetkffndaietykgrpfdfkqlitnavsnitnliifgerftyedtdfqhmielfsenv
    elaasasvflynafpwigilpfgkhqqlfrnaavvydflsrliekasvnrkpqlpqhfvd
    ayldemdqgkndpsstfskenlifsvgeliiagtetttnvlrwailfmalypniqgqvqk
    eidlimgpngkpswddkckmpyteavlhevlrfcnivplgifhatsedavvrgysipkgt
    tvitnlysvhfdekywrdpevfhperfldssgyfakkealvpfslgrrhclgehlarmem
    flfftallqrfhlhfphelvpdlkprlgmtlqpqpylicaerrh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2ojdB (B:)
    makktkqrrpmgfppgppglpfigniyslaasselphvymrkqsqvygeifsldlggist
    vvlngydvvkeclvhqseifadrpclplfmkmtkmggllnsrygrgwvdhrrlavnsfry
    fgygqksfeskileetkffndaietykgrpfdfkqlitnavsnitnliifgerftyedtd
    fqhmielfsenvelaasasvflynafpwigilpfgkhqqlfrnaavvydflsrliekasv
    nrkpqlpqhfvdayldemdqgkndpsstfskenlifsvgeliiagtetttnvlrwailfm
    alypniqgqvqkeidlimgpngkpswddkckmpyteavlhevlrfcnivplgifhatsed
    avvrgysipkgttvitnlysvhfdekywrdpevfhperfldssgyfakkealvpfslgrr
    hclgehlarmemflfftallqrfhlhfphelvpdlkprlgmtlqpqpylicaerrhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ojdB (B:)
    fppgppglpfigniyslaasselphvymrkqsqvygeifsldlggistvvlngydvvkec
    lvhqseifadrpclplfmkmtkmggllnsrygrgwvdhrrlavnsfryfgygqksfeski
    leetkffndaietykgrpfdfkqlitnavsnitnliifgerftyedtdfqhmielfsenv
    elaasasvflynafpwigilpfgkhqqlfrnaavvydflsrliekasvnrkpqlpqhfvd
    ayldemdqgkndpsstfskenlifsvgeliiagtetttnvlrwailfmalypniqgqvqk
    eidlimgpngkpswddkckmpyteavlhevlrfcnivplgifhatsedavvrgysipkgt
    tvitnlysvhfdekywrdpevfhperfldssgyfakkealvpfslgrrhclgehlarmem
    flfftallqrfhlhfphelvpdlkprlgmtlqpqpylicaerrhhhh