PDB entry 2oj6

View 2oj6 on RCSB PDB site
Description: Crystal Structure of Reovirus T3D Attachment Protein Sigma1 head domain D345N mutant
Class: viral protein
Keywords: beta-barrel, beta-spiral repeat, aspartic acid cluster, greek key motif, trimer, Viral protein
Deposited on 2007-01-12, released 2007-02-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Viral attachment protein sigma 1
    Species: Reovirus sp. [TaxId:10891]
    Gene: S1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q86337 (Start-164)
      • engineered (54)
    Domains in SCOPe 2.07: d2oj6a1
  • Chain 'B':
    Compound: Viral attachment protein sigma 1
    Species: Reovirus sp. [TaxId:10891]
    Gene: S1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q86337 (Start-164)
      • engineered (54)
    Domains in SCOPe 2.07: d2oj6b1
  • Chain 'C':
    Compound: Viral attachment protein sigma 1
    Species: Reovirus sp. [TaxId:10891]
    Gene: S1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q86337 (2-End)
      • engineered (54)
    Domains in SCOPe 2.07: d2oj6c1, d2oj6c2
  • Chain 'D':
    Compound: Viral attachment protein sigma 1
    Species: Reovirus sp. [TaxId:10891]
    Gene: S1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q86337
      • engineered (54)
    Domains in SCOPe 2.07: d2oj6d1
  • Chain 'E':
    Compound: Viral attachment protein sigma 1
    Species: Reovirus sp. [TaxId:10891]
    Gene: S1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q86337
      • engineered (54)
    Domains in SCOPe 2.07: d2oj6e1
  • Chain 'F':
    Compound: Viral attachment protein sigma 1
    Species: Reovirus sp. [TaxId:10891]
    Gene: S1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q86337 (Start-164)
      • engineered (54)
    Domains in SCOPe 2.07: d2oj6f1
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2oj6A (A:)
    gsspnlrypiadvsggigmspnyrfrqsmwigivsysgsglnwrvqvnsdifivndyihi
    clpafdgfsiadggdlslnfvtgllpplltgdtepafhndvvtygaqtvaiglssggtpq
    ymsknlwveqwqdgvlrlrvegggsithsnskwpamtvsyprsft
    

    Sequence, based on observed residues (ATOM records): (download)
    >2oj6A (A:)
    pnlrypiadvsggigmspnyrfrqsmwigivsysgsglnwrvqvnsdifivndyihiclp
    afdgfsiadggdlslnfvtgllpplltgdtepafhndvvtygaqtvaiglssggtpqyms
    knlwveqwqdgvlrlrvegggsithsnskwpamtvsyprsft
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2oj6B (B:)
    gsspnlrypiadvsggigmspnyrfrqsmwigivsysgsglnwrvqvnsdifivndyihi
    clpafdgfsiadggdlslnfvtgllpplltgdtepafhndvvtygaqtvaiglssggtpq
    ymsknlwveqwqdgvlrlrvegggsithsnskwpamtvsyprsft
    

    Sequence, based on observed residues (ATOM records): (download)
    >2oj6B (B:)
    pnlrypiadvsggigmspnyrfrqsmwigivsysgsglnwrvqvnsdifivndyihiclp
    afdgfsiadggdlslnfvtgllpplltgdtepafhndvvtygaqtvaiglssggtpqyms
    knlwveqwqdgvlrlrvegggsithsnskwpamtvsyprsft
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2oj6C (C:)
    gsspnlrypiadvsggigmspnyrfrqsmwigivsysgsglnwrvqvnsdifivndyihi
    clpafdgfsiadggdlslnfvtgllpplltgdtepafhndvvtygaqtvaiglssggtpq
    ymsknlwveqwqdgvlrlrvegggsithsnskwpamtvsyprsft
    

    Sequence, based on observed residues (ATOM records): (download)
    >2oj6C (C:)
    spnlrypiadvsggigmspnyrfrqsmwigivsysgsglnwrvqvnsdifivndyihicl
    pafdgfsiadggdlslnfvtgllpplltgdtepafhndvvtygaqtvaiglssggtpqym
    sknlwveqwqdgvlrlrvegggsithsnskwpamtvsyprsf
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2oj6D (D:)
    gsspnlrypiadvsggigmspnyrfrqsmwigivsysgsglnwrvqvnsdifivndyihi
    clpafdgfsiadggdlslnfvtgllpplltgdtepafhndvvtygaqtvaiglssggtpq
    ymsknlwveqwqdgvlrlrvegggsithsnskwpamtvsyprsft
    

    Sequence, based on observed residues (ATOM records): (download)
    >2oj6D (D:)
    nlrypiadvsggigmspnyrfrqsmwigivsysgsglnwrvqvnsdifivndyihiclpa
    fdgfsiadggdlslnfvtgllpplltgdtepafhndvvtygaqtvaiglssggtpqymsk
    nlwveqwqdgvlrlrvegggsithsnskwpamtvsyprsf
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2oj6E (E:)
    gsspnlrypiadvsggigmspnyrfrqsmwigivsysgsglnwrvqvnsdifivndyihi
    clpafdgfsiadggdlslnfvtgllpplltgdtepafhndvvtygaqtvaiglssggtpq
    ymsknlwveqwqdgvlrlrvegggsithsnskwpamtvsyprsft
    

    Sequence, based on observed residues (ATOM records): (download)
    >2oj6E (E:)
    pnlrypiadvsggigmspnyrfrqsmwigivsysgsglnwrvqvnsdifivndyihiclp
    afdgfsiadggdlslnfvtgllpplltgdtepafhndvvtygaqtvaiglssggtpqyms
    knlwveqwqdgvlrlrvegggsithsnskwpamtvsyprsf
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2oj6F (F:)
    gsspnlrypiadvsggigmspnyrfrqsmwigivsysgsglnwrvqvnsdifivndyihi
    clpafdgfsiadggdlslnfvtgllpplltgdtepafhndvvtygaqtvaiglssggtpq
    ymsknlwveqwqdgvlrlrvegggsithsnskwpamtvsyprsft
    

    Sequence, based on observed residues (ATOM records): (download)
    >2oj6F (F:)
    pnlrypiadvsggigmspnyrfrqsmwigivsysgsglnwrvqvnsdifivndyihiclp
    afdgfsiadggdlslnfvtgllpplltgdtepafhndvvtygaqtvaiglssggtpqyms
    knlwveqwqdgvlrlrvegggsithsnskwpamtvsyprsft